DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and AT2G03430

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_178442.2 Gene:AT2G03430 / 814872 AraportID:AT2G03430 Length:240 Species:Arabidopsis thaliana


Alignment Length:293 Identity:89/293 - (30%)
Similarity:128/293 - (43%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 QLASDSVLKLLKNPPDSETHLLEAAKAGDLD---TVRRIVLNNPISVNCRDLDGRHSTPLHFAAG 529
            ::|:|:.    |...|.|  |.:||:.||..   ::....|:.  |:|.|:.|||  :.||.||.
plant     2 EIATDTA----KQMRDEE--LFKAAEWGDSSLFMSLSEEQLSK--SLNFRNEDGR--SLLHVAAS 56

  Fly   530 FNRVPVVQFLL---EHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLH 591
            |....:|:.|.   |....:.:.|..|..|||:|.|.|:.|:.|:|:..||:||..:....|.||
plant    57 FGHSQIVKLLSSSDEAKTVINSKDDEGWAPLHSAASIGNAELVEVLLTRGADVNAKNNGGRTALH 121

  Fly   592 EAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQ 656
            .||:||:.:|.:|||.|||                                              
plant   122 YAASKGRLEIAQLLLTHGA---------------------------------------------- 140

  Fly   657 RLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDI 721
                  .||..|..|  .||||.||.....|..|:|:|.||:::|.||.|...|.::.......:
plant   141 ------KINITDKVG--CTPLHRAASVGKLEVCEFLIEEGAEIDATDKMGQTALMHSVICDDKQV 197

  Fly   722 AALLIKHKTVVNATDKWGFTPLHEAAQKGRTQL 754
            |.|||:|...|:..||.|:|.|..|..:.|..|
plant   198 AFLLIRHGADVDVEDKEGYTVLGRATNEFRPAL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125
ANK repeat 59..87 CDD:293786
Ank_2 61..153 CDD:289560
ANK repeat 89..120 CDD:293786
ANK repeat 122..153 CDD:293786
ANK 202..316 CDD:238125
ANK repeat 212..240 CDD:293786
Ank_2 214..306 CDD:289560
ANK repeat 242..273 CDD:293786
ANK repeat 275..306 CDD:293786
ANK 361..478 CDD:238125 2/9 (22%)
ANK repeat 363..396 CDD:293786
Ank_2 367..459 CDD:289560
ANK 393..573 CDD:238125 35/110 (32%)
ANK repeat 398..429 CDD:293786
ANK repeat 431..459 CDD:293786
ANK repeat 483..515 CDD:293786 10/34 (29%)
Ank_4 486..540 CDD:290365 18/56 (32%)
ANK 512..637 CDD:238125 42/127 (33%)
ANK repeat 522..550 CDD:293786 8/30 (27%)
Ank_2 524..616 CDD:289560 37/94 (39%)
ANK repeat 552..583 CDD:293786 14/30 (47%)
ANK repeat 585..610 CDD:293786 12/24 (50%)
ANK repeat 638..668 CDD:293786 2/29 (7%)
Ank_4 641..693 CDD:290365 12/51 (24%)
ANK 665..779 CDD:238125 34/90 (38%)
ANK repeat 672..703 CDD:293786 13/30 (43%)
Ank_2 677..769 CDD:289560 29/78 (37%)
ANK repeat 705..736 CDD:293786 8/30 (27%)
ANK repeat 738..769 CDD:293786 6/17 (35%)
SAM_tankyrase1,2 887..952 CDD:188923
SAM 890..952 CDD:197735
tankyrase_like 948..1170 CDD:238718
PARP 961..1165 CDD:279038
AT2G03430NP_178442.2 ANKYR 13..210 CDD:223738 78/256 (30%)
ANK repeat 46..80 CDD:293786 11/35 (31%)
ANK repeat 82..113 CDD:293786 14/30 (47%)
Ank_2 87..179 CDD:403870 43/145 (30%)
ANK repeat 115..146 CDD:293786 16/82 (20%)
ANK repeat 148..179 CDD:293786 14/32 (44%)
ANK repeat 181..212 CDD:293786 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2871
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.