| Sequence 1: | NP_001262963.1 | Gene: | Tnks / 43095 | FlyBaseID: | FBgn0027508 | Length: | 1520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_999957.1 | Gene: | asb11 / 791758 | ZFINID: | ZDB-GENE-070112-532 | Length: | 293 | Species: | Danio rerio |
| Alignment Length: | 277 | Identity: | 89/277 - (32%) |
|---|---|---|---|
| Similarity: | 119/277 - (42%) | Gaps: | 56/277 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 522 TPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWK 586
Fly 587 FTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGN 651
Fly 652 LARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSY 716
Fly 717 GHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELATA 781
Fly 782 DDVKCLLQDAMATSLSQ 798 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tnks | NP_001262963.1 | ANK | 49..163 | CDD:238125 | |
| ANK repeat | 59..87 | CDD:293786 | |||
| Ank_2 | 61..153 | CDD:289560 | |||
| ANK repeat | 89..120 | CDD:293786 | |||
| ANK repeat | 122..153 | CDD:293786 | |||
| ANK | 202..316 | CDD:238125 | |||
| ANK repeat | 212..240 | CDD:293786 | |||
| Ank_2 | 214..306 | CDD:289560 | |||
| ANK repeat | 242..273 | CDD:293786 | |||
| ANK repeat | 275..306 | CDD:293786 | |||
| ANK | 361..478 | CDD:238125 | |||
| ANK repeat | 363..396 | CDD:293786 | |||
| Ank_2 | 367..459 | CDD:289560 | |||
| ANK | 393..573 | CDD:238125 | 20/50 (40%) | ||
| ANK repeat | 398..429 | CDD:293786 | |||
| ANK repeat | 431..459 | CDD:293786 | |||
| ANK repeat | 483..515 | CDD:293786 | |||
| Ank_4 | 486..540 | CDD:290365 | 7/17 (41%) | ||
| ANK | 512..637 | CDD:238125 | 36/114 (32%) | ||
| ANK repeat | 522..550 | CDD:293786 | 11/27 (41%) | ||
| Ank_2 | 524..616 | CDD:289560 | 31/91 (34%) | ||
| ANK repeat | 552..583 | CDD:293786 | 13/30 (43%) | ||
| ANK repeat | 585..610 | CDD:293786 | 8/24 (33%) | ||
| ANK repeat | 638..668 | CDD:293786 | 10/29 (34%) | ||
| Ank_4 | 641..693 | CDD:290365 | 13/51 (25%) | ||
| ANK | 665..779 | CDD:238125 | 32/113 (28%) | ||
| ANK repeat | 672..703 | CDD:293786 | 10/30 (33%) | ||
| Ank_2 | 677..769 | CDD:289560 | 25/91 (27%) | ||
| ANK repeat | 705..736 | CDD:293786 | 3/30 (10%) | ||
| ANK repeat | 738..769 | CDD:293786 | 13/30 (43%) | ||
| SAM_tankyrase1,2 | 887..952 | CDD:188923 | |||
| SAM | 890..952 | CDD:197735 | |||
| tankyrase_like | 948..1170 | CDD:238718 | |||
| PARP | 961..1165 | CDD:279038 | |||
| asb11 | NP_999957.1 | ANK | 36..155 | CDD:238125 | 46/136 (34%) |
| Ank_2 | <36..99 | CDD:289560 | 25/59 (42%) | ||
| ANK repeat | 36..67 | CDD:293786 | 11/27 (41%) | ||
| ANK repeat | 69..100 | CDD:293786 | 13/30 (43%) | ||
| Ank_2 | 74..164 | CDD:289560 | 35/111 (32%) | ||
| ANK repeat | 136..165 | CDD:293786 | 10/31 (32%) | ||
| Ank_2 | 139..230 | CDD:289560 | 35/125 (28%) | ||
| ANK repeat | 167..197 | CDD:293786 | 10/30 (33%) | ||
| ANK repeat | 199..230 | CDD:293786 | 16/63 (25%) | ||
| SOCS_ASB_like | 255..293 | CDD:239686 | 4/5 (80%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||