Sequence 1: | NP_001262963.1 | Gene: | Tnks / 43095 | FlyBaseID: | FBgn0027508 | Length: | 1520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
Alignment Length: | 216 | Identity: | 49/216 - (22%) |
---|---|---|---|
Similarity: | 87/216 - (40%) | Gaps: | 55/216 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 497 LDTVRRIVLNN--------PISVNCRDLDGRH---STPL----HFAAGFNRVP-VVQFLLEHGAE 545
Fly 546 VYAADKGGLVPLHNACSYGHY--------EVTELLVKHGANVNVSDLWKFTPLHEA--AAKGKYD 600
Fly 601 ICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPS-ALLDAAKKGNLARVQRLVTPESI 664
Fly 665 NCRDAQGRNSTPLHLAAGYNN 685 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tnks | NP_001262963.1 | ANK | 49..163 | CDD:238125 | |
ANK repeat | 59..87 | CDD:293786 | |||
Ank_2 | 61..153 | CDD:289560 | |||
ANK repeat | 89..120 | CDD:293786 | |||
ANK repeat | 122..153 | CDD:293786 | |||
ANK | 202..316 | CDD:238125 | |||
ANK repeat | 212..240 | CDD:293786 | |||
Ank_2 | 214..306 | CDD:289560 | |||
ANK repeat | 242..273 | CDD:293786 | |||
ANK repeat | 275..306 | CDD:293786 | |||
ANK | 361..478 | CDD:238125 | |||
ANK repeat | 363..396 | CDD:293786 | |||
Ank_2 | 367..459 | CDD:289560 | |||
ANK | 393..573 | CDD:238125 | 21/99 (21%) | ||
ANK repeat | 398..429 | CDD:293786 | |||
ANK repeat | 431..459 | CDD:293786 | |||
ANK repeat | 483..515 | CDD:293786 | 6/25 (24%) | ||
Ank_4 | 486..540 | CDD:290365 | 13/58 (22%) | ||
ANK | 512..637 | CDD:238125 | 28/142 (20%) | ||
ANK repeat | 522..550 | CDD:293786 | 6/32 (19%) | ||
Ank_2 | 524..616 | CDD:289560 | 21/106 (20%) | ||
ANK repeat | 552..583 | CDD:293786 | 7/38 (18%) | ||
ANK repeat | 585..610 | CDD:293786 | 8/26 (31%) | ||
ANK repeat | 638..668 | CDD:293786 | 7/30 (23%) | ||
Ank_4 | 641..693 | CDD:290365 | 13/46 (28%) | ||
ANK | 665..779 | CDD:238125 | 7/21 (33%) | ||
ANK repeat | 672..703 | CDD:293786 | 4/14 (29%) | ||
Ank_2 | 677..769 | CDD:289560 | 3/9 (33%) | ||
ANK repeat | 705..736 | CDD:293786 | |||
ANK repeat | 738..769 | CDD:293786 | |||
SAM_tankyrase1,2 | 887..952 | CDD:188923 | |||
SAM | 890..952 | CDD:197735 | |||
tankyrase_like | 948..1170 | CDD:238718 | |||
PARP | 961..1165 | CDD:279038 | |||
CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 16/73 (22%) |
GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 31/131 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |