DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and ANKDD1B

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:XP_016865303.1 Gene:ANKDD1B / 728780 HGNCID:32525 Length:563 Species:Homo sapiens


Alignment Length:426 Identity:110/426 - (25%)
Similarity:172/426 - (40%) Gaps:91/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 QGAKVNALDSLGQTPLHRCARDEQAVR------LLLSYAADTNIVSLEGLTAAQLASDSVLKLLK 479
            |||....|       |.|.|...:.:|      ..|.:.:.:.|...|||.....|......||.
Human    10 QGATAGGL-------LLRAAAAAKGLREDLWGAAALPWRSLSRIPKREGLGEEDTAVAGHELLLP 67

  Fly   480 NPPDSETHLLEAAKAGDLDTVRRIVLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGA 544
            |    |.....|||:.:||.:.::...   .||...::..:.|.||||.|.|.:..|.|||:|.|
Human    68 N----ERSFQNAAKSNNLDLMEKLFEK---KVNINVVNNMNRTALHFAVGRNHLSAVDFLLKHKA 125

  Fly   545 EVYAADKGGLVPLHNACSYGHYEVTELLVKHGAN---VNVSDLW-----KFTPLHEAAAKGKYDI 601
            .|..|||.||..:|.|...|..||..:|||.||:   .|...:|     |..|.|          
Human   126 RVDVADKHGLTVIHLAAWSGSLEVMLMLVKAGADQRAKNQVGMWVTPGQKLLPHH---------- 180

  Fly   602 CK---LLLKHGADPMKKN-RDGATPADLVKESDH-DVAELL--------------RGPSALLDAA 647
            |:   :|......|...: :||.:......:|:| .:.|.|              :|....|.||
Human   181 CRREEVLRSLSISPTPGSLQDGMSALHFATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAA 245

  Fly   648 KKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHN 712
            ::|::..:::| |..:::..:.....:|.|||||.:.:....:.||....|:|..::..:..|..
Human   246 ERGHVEMIEKL-TFLNLHTSEKDKGGNTALHLAAKHGHSPAVQVLLAQWQDINEMNELNISSLQI 309

  Fly   713 ASSYGHLDIAALLI-----------------------KHKTVVNA----------TDKWGFTPLH 744
            |:..||..:...|:                       .|.||||:          .::...||||
Human   310 ATRNGHASLVNFLLSENVDLHQKVEPKESPLHLVVINNHITVVNSLLSAQHDIDILNQKQQTPLH 374

  Fly   745 EAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELAT 780
            .||.:|..:|...||..|.|....:::|:|.:.:|:
Human   375 VAADRGNVELVETLLKAGCDLKAVDKQGKTALAVAS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125
ANK repeat 59..87 CDD:293786
Ank_2 61..153 CDD:289560
ANK repeat 89..120 CDD:293786
ANK repeat 122..153 CDD:293786
ANK 202..316 CDD:238125
ANK repeat 212..240 CDD:293786
Ank_2 214..306 CDD:289560
ANK repeat 242..273 CDD:293786
ANK repeat 275..306 CDD:293786
ANK 361..478 CDD:238125 14/62 (23%)
ANK repeat 363..396 CDD:293786
Ank_2 367..459 CDD:289560 9/43 (21%)
ANK 393..573 CDD:238125 49/157 (31%)
ANK repeat 398..429 CDD:293786 3/7 (43%)
ANK repeat 431..459 CDD:293786 5/33 (15%)
ANK repeat 483..515 CDD:293786 8/31 (26%)
Ank_4 486..540 CDD:290365 16/53 (30%)
ANK 512..637 CDD:238125 43/137 (31%)
ANK repeat 522..550 CDD:293786 14/27 (52%)
Ank_2 524..616 CDD:289560 36/102 (35%)
ANK repeat 552..583 CDD:293786 13/33 (39%)
ANK repeat 585..610 CDD:293786 6/32 (19%)
ANK repeat 638..668 CDD:293786 7/29 (24%)
Ank_4 641..693 CDD:290365 12/51 (24%)
ANK 665..779 CDD:238125 34/146 (23%)
ANK repeat 672..703 CDD:293786 10/30 (33%)
Ank_2 677..769 CDD:289560 31/124 (25%)
ANK repeat 705..736 CDD:293786 10/63 (16%)
ANK repeat 738..769 CDD:293786 12/30 (40%)
SAM_tankyrase1,2 887..952 CDD:188923
SAM 890..952 CDD:197735
tankyrase_like 948..1170 CDD:238718
PARP 961..1165 CDD:279038
ANKDD1BXP_016865303.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.