DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and ankrd45

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_001018606.1 Gene:ankrd45 / 553808 ZFINID:ZDB-GENE-050522-311 Length:224 Species:Danio rerio


Alignment Length:117 Identity:32/117 - (27%)
Similarity:49/117 - (41%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWA--FTPLHEAASKSRVEVCSLLLSRGAD 301
            ||:.|...|..||..|...:.:.|:|.|| .:.|:|.|  ::|||.:|...:::....|:...||
Zfish    43 KDEVGRNALFAACMMGRSAIVRELVQNGA-ADVNELTARGYSPLHCSAMWGQLDTLKTLVELNAD 106

  Fly   302 PTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACRKCDVSRAKKLVCAE 353
            ...:|...:.|:|.|                      |:.|     ||.|||
Zfish   107 FQAINFRGEKAVDVA----------------------RRYD-----KLDCAE 131

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125
ANK repeat 59..87 CDD:293786
Ank_2 61..153 CDD:289560
ANK repeat 89..120 CDD:293786
ANK repeat 122..153 CDD:293786
ANK 202..316 CDD:238125 24/78 (31%)