DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and ANKFY1

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:XP_016880222.1 Gene:ANKFY1 / 51479 HGNCID:20763 Length:1273 Species:Homo sapiens


Alignment Length:875 Identity:217/875 - (24%)
Similarity:335/875 - (38%) Gaps:214/875 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ELFEACKTGEIA-------KVKKLIT-----PQTVNARDTAGRKSTPLHFAAGYGRREVVEFLLN 78
            :|.||...|::|       :::.:.|     ...|:..|.:|  .:.||.....|......||:.
Human   352 KLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSG--WSLLHKGIQRGDLFAATFLIK 414

  Fly    79 SGASIQACDEGGLH-PLHNCCSFGH-----------AEVVRLLLKAGASPNTTDNWNYTPLHEAA 131
            :||.:.|...|... |||....:..           |::...||:|||:||..|:...||||.:.
Human   415 NGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVSI 479

  Fly   132 SKGKVDVCLALLQ-HGANHTIRNSEQKTPLELA--------DEATRPVLTGEYRKDELLEAARSG 187
            ..|...|...||| ...:..:::.|..|.|.||        |::..|.      :|..:....|.
Human   480 MAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSVNPF------EDVPVVNGTSF 538

  Fly   188 AEDRLLALLTPLNVNCHASD-GRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNAC 251
            .|:...|.|.....:..|.| ...:..|..|||.........|..|||.|:.::|.|..|||.||
Human   539 DENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVNHRNKWGETPLHTAC 603

  Fly   252 SYGHFDVTKLLIQAGANVN-------------------ANDLWAFTPLHEAASKSRVEVCSLLLS 297
            .:|..::|..|:|.|||.|                   |:.:...||||.|.:.:..:|.|::|.
Human   604 RHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADSVHLQTPLHMAIAYNHPDVVSVILE 668

  Fly   298 RGADPTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACRKCDVSRAKKLVCAEIVNFVHPYT 362
            :.|:.    .|:.:.:...|...|:                                        
Human   669 QKANA----LHATNNLQIIPDFSLK---------------------------------------- 689

  Fly   363 GDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLH-LAAELLHYDAMEVLLKQGAKVN 426
                        |.:.:.::.|             |..|.:| :||:         ||..||.:|
Human   690 ------------DSRDQTVLGL-------------ALWTGMHTIAAQ---------LLGSGAAIN 720

  Fly   427 ALDSLGQTPLHRC--ARDEQAVRLLLSYAADTNIVSLEGLTAAQLASDSVLKLL----------- 478
            ...|.|||.||..  .:|.::...||.:.||.|:.:.:|.||.|||..:.|.|:           
Human   721 DTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQLAIRNQLPLVVDAICTRGADM 785

  Fly   479 ------KNPPDSETHLLEAAKAGDLDTVRRIVLNNPISVNC--RDLDGRHSTPLHFAAGFNRVPV 535
                  .|||      |..|.|.:|:.:...::.:.....|  ....|...|.||.|...|..|.
Human   786 SVPDEKGNPP------LWLALANNLEDIASTLVRHGCDATCWGPGPGGCLQTLLHRAIDENNEPT 844

  Fly   536 VQFLLEHGAEVYA------------ADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFT 588
            ..||:..|.:|.:            ..:.|..|||.|.|:|..|..:.|::.|||||..|....|
Human   845 ACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRT 909

  Fly   589 PLHEAAAKGKYDICKLLLKHGADPMK-KNRDGATP--ADLVKESDHDVAELLRGPSALLDAAKKG 650
            |:|.|.:.....|.:||:.|....:. ::|.|.||  ..:..:::.....:|:..|...:..   
Human   910 PIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQV--- 971

  Fly   651 NLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNA--QDKGGLIPLHNA 713
                             |.:|||.  ||:|...::.|...:|:...|:||:  ||...|.|||.|
Human   972 -----------------DNKGRNF--LHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLA 1017

  Fly   714 SSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIEL 778
            ...|...|...|:.....||...|...|.||.|||:....:||:||.:|.|....::.|...:.|
Human  1018 VQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHL 1082

  Fly   779 AT----ADDVKCLLQ----DAMATSLSQQA 800
            |.    .::::.||.    ||.|.:|..|:
Human  1083 AVMHGRLNNIRVLLTECTVDAEAFNLRGQS 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125 35/126 (28%)
ANK repeat 59..87 CDD:293786 8/27 (30%)
Ank_2 61..153 CDD:289560 30/104 (29%)
ANK repeat 89..120 CDD:293786 12/42 (29%)
ANK repeat 122..153 CDD:293786 9/31 (29%)
ANK 202..316 CDD:238125 37/133 (28%)
ANK repeat 212..240 CDD:293786 9/27 (33%)
Ank_2 214..306 CDD:289560 34/110 (31%)
ANK repeat 242..273 CDD:293786 15/49 (31%)
ANK repeat 275..306 CDD:293786 9/30 (30%)
ANK 361..478 CDD:238125 31/119 (26%)
ANK repeat 363..396 CDD:293786 2/32 (6%)
Ank_2 367..459 CDD:289560 24/94 (26%)
ANK 393..573 CDD:238125 57/213 (27%)
ANK repeat 398..429 CDD:293786 10/31 (32%)
ANK repeat 431..459 CDD:293786 11/29 (38%)
ANK repeat 483..515 CDD:293786 5/33 (15%)
Ank_4 486..540 CDD:290365 13/55 (24%)
ANK 512..637 CDD:238125 39/141 (28%)
ANK repeat 522..550 CDD:293786 10/39 (26%)
Ank_2 524..616 CDD:289560 32/104 (31%)
ANK repeat 552..583 CDD:293786 14/30 (47%)
ANK repeat 585..610 CDD:293786 8/24 (33%)
ANK repeat 638..668 CDD:293786 1/29 (3%)
Ank_4 641..693 CDD:290365 9/51 (18%)
ANK 665..779 CDD:238125 38/115 (33%)
ANK repeat 672..703 CDD:293786 10/32 (31%)
Ank_2 677..769 CDD:289560 33/93 (35%)
ANK repeat 705..736 CDD:293786 10/30 (33%)
ANK repeat 738..769 CDD:293786 12/30 (40%)
SAM_tankyrase1,2 887..952 CDD:188923
SAM 890..952 CDD:197735
tankyrase_like 948..1170 CDD:238718
PARP 961..1165 CDD:279038
ANKFY1XP_016880222.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115202at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.