Sequence 1: | NP_001262963.1 | Gene: | Tnks / 43095 | FlyBaseID: | FBgn0027508 | Length: | 1520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009298394.1 | Gene: | asb13a.1 / 436801 | ZFINID: | ZDB-GENE-040718-261 | Length: | 311 | Species: | Danio rerio |
Alignment Length: | 314 | Identity: | 92/314 - (29%) |
---|---|---|---|
Similarity: | 142/314 - (45%) | Gaps: | 55/314 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 TPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWA 276
Fly 277 FTPLHEAASKSRVEVCSLLLSRGA--DPTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACR 339
Fly 340 KCDVSRAKKLVCAEIVNFVHPYTGDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLH 404
Fly 405 LAAELLHYDAMEVLLKQGAKVNALDSLGQTPLHRCARDEQ--AVRLLLSYAADTNIVSLEGLTAA 467
Fly 468 QLASDSVLKLLKN--PPDSETHLL---EAAKAGDLDTVRRIVLNNPISVNCRDL 516 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tnks | NP_001262963.1 | ANK | 49..163 | CDD:238125 | |
ANK repeat | 59..87 | CDD:293786 | |||
Ank_2 | 61..153 | CDD:289560 | |||
ANK repeat | 89..120 | CDD:293786 | |||
ANK repeat | 122..153 | CDD:293786 | |||
ANK | 202..316 | CDD:238125 | 35/105 (33%) | ||
ANK repeat | 212..240 | CDD:293786 | 11/27 (41%) | ||
Ank_2 | 214..306 | CDD:289560 | 32/93 (34%) | ||
ANK repeat | 242..273 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 275..306 | CDD:293786 | 11/32 (34%) | ||
ANK | 361..478 | CDD:238125 | 40/118 (34%) | ||
ANK repeat | 363..396 | CDD:293786 | 9/32 (28%) | ||
Ank_2 | 367..459 | CDD:289560 | 36/93 (39%) | ||
ANK | 393..573 | CDD:238125 | 39/131 (30%) | ||
ANK repeat | 398..429 | CDD:293786 | 16/30 (53%) | ||
ANK repeat | 431..459 | CDD:293786 | 11/29 (38%) | ||
ANK repeat | 483..515 | CDD:293786 | 7/34 (21%) | ||
Ank_4 | 486..540 | CDD:290365 | 6/34 (18%) | ||
ANK | 512..637 | CDD:238125 | 1/5 (20%) | ||
ANK repeat | 522..550 | CDD:293786 | |||
Ank_2 | 524..616 | CDD:289560 | |||
ANK repeat | 552..583 | CDD:293786 | |||
ANK repeat | 585..610 | CDD:293786 | |||
ANK repeat | 638..668 | CDD:293786 | |||
Ank_4 | 641..693 | CDD:290365 | |||
ANK | 665..779 | CDD:238125 | |||
ANK repeat | 672..703 | CDD:293786 | |||
Ank_2 | 677..769 | CDD:289560 | |||
ANK repeat | 705..736 | CDD:293786 | |||
ANK repeat | 738..769 | CDD:293786 | |||
SAM_tankyrase1,2 | 887..952 | CDD:188923 | |||
SAM | 890..952 | CDD:197735 | |||
tankyrase_like | 948..1170 | CDD:238718 | |||
PARP | 961..1165 | CDD:279038 | |||
asb13a.1 | XP_009298394.1 | ANK repeat | 20..49 | CDD:293786 | 11/27 (41%) |
Ank_2 | 24..112 | CDD:289560 | 30/87 (34%) | ||
ANK | 46..197 | CDD:238125 | 50/183 (27%) | ||
ANK repeat | 51..82 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 84..112 | CDD:293786 | 9/27 (33%) | ||
ANK | 151..248 | CDD:238125 | 39/114 (34%) | ||
Ank_2 | 151..239 | CDD:289560 | 37/105 (35%) | ||
ANK repeat | 176..206 | CDD:293786 | 16/30 (53%) | ||
ANK repeat | 208..239 | CDD:293786 | 12/42 (29%) | ||
SOCS_ASB13 | 264..305 | CDD:239699 | 4/25 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |