| Sequence 1: | NP_001262963.1 | Gene: | Tnks / 43095 | FlyBaseID: | FBgn0027508 | Length: | 1520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_991317.1 | Gene: | psmd10 / 403085 | ZFINID: | ZDB-GENE-050112-1 | Length: | 226 | Species: | Danio rerio |
| Alignment Length: | 296 | Identity: | 86/296 - (29%) |
|---|---|---|---|
| Similarity: | 119/296 - (40%) | Gaps: | 89/296 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 484 SETHLLEAAKAGDLDTVRRIVLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYA 548
Fly 549 ADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPM 613
Fly 614 KKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQRLVTPESINCRDAQGRNSTPLH 678
Fly 679 LAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPL 743
Fly 744 HEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tnks | NP_001262963.1 | ANK | 49..163 | CDD:238125 | |
| ANK repeat | 59..87 | CDD:293786 | |||
| Ank_2 | 61..153 | CDD:289560 | |||
| ANK repeat | 89..120 | CDD:293786 | |||
| ANK repeat | 122..153 | CDD:293786 | |||
| ANK | 202..316 | CDD:238125 | |||
| ANK repeat | 212..240 | CDD:293786 | |||
| Ank_2 | 214..306 | CDD:289560 | |||
| ANK repeat | 242..273 | CDD:293786 | |||
| ANK repeat | 275..306 | CDD:293786 | |||
| ANK | 361..478 | CDD:238125 | |||
| ANK repeat | 363..396 | CDD:293786 | |||
| Ank_2 | 367..459 | CDD:289560 | |||
| ANK | 393..573 | CDD:238125 | 23/88 (26%) | ||
| ANK repeat | 398..429 | CDD:293786 | |||
| ANK repeat | 431..459 | CDD:293786 | |||
| ANK repeat | 483..515 | CDD:293786 | 5/30 (17%) | ||
| Ank_4 | 486..540 | CDD:290365 | 14/53 (26%) | ||
| ANK | 512..637 | CDD:238125 | 32/124 (26%) | ||
| ANK repeat | 522..550 | CDD:293786 | 12/27 (44%) | ||
| Ank_2 | 524..616 | CDD:289560 | 26/91 (29%) | ||
| ANK repeat | 552..583 | CDD:293786 | 2/30 (7%) | ||
| ANK repeat | 585..610 | CDD:293786 | 10/24 (42%) | ||
| ANK repeat | 638..668 | CDD:293786 | 0/29 (0%) | ||
| Ank_4 | 641..693 | CDD:290365 | 9/51 (18%) | ||
| ANK | 665..779 | CDD:238125 | 48/113 (42%) | ||
| ANK repeat | 672..703 | CDD:293786 | 18/30 (60%) | ||
| Ank_2 | 677..769 | CDD:289560 | 42/91 (46%) | ||
| ANK repeat | 705..736 | CDD:293786 | 10/30 (33%) | ||
| ANK repeat | 738..769 | CDD:293786 | 13/30 (43%) | ||
| SAM_tankyrase1,2 | 887..952 | CDD:188923 | |||
| SAM | 890..952 | CDD:197735 | |||
| tankyrase_like | 948..1170 | CDD:238718 | |||
| PARP | 961..1165 | CDD:279038 | |||
| psmd10 | NP_991317.1 | Ank_4 | 13..60 | CDD:290365 | 14/48 (29%) |
| ANK repeat | 39..70 | CDD:293786 | 14/32 (44%) | ||
| ANK | 39..68 | CDD:197603 | 14/30 (47%) | ||
| Ank_2 | 44..136 | CDD:289560 | 46/178 (26%) | ||
| ANK | 67..192 | CDD:238125 | 56/211 (27%) | ||
| ANK repeat | 72..103 | CDD:293786 | 14/55 (25%) | ||
| ANK repeat | 105..136 | CDD:293786 | 19/84 (23%) | ||
| Ank_2 | 110..202 | CDD:289560 | 42/91 (46%) | ||
| ANK repeat | 138..169 | CDD:293786 | 10/30 (33%) | ||
| ANK repeat | 171..202 | CDD:293786 | 13/30 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1759 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||