DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and Tiparp

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_001101149.2 Gene:Tiparp / 310467 RGDID:1306171 Length:657 Species:Rattus norvegicus


Alignment Length:361 Identity:81/361 - (22%)
Similarity:129/361 - (35%) Gaps:139/361 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 SSAILSPTTETV-LLPTGASMILSVPVPLPLSSSTRISPAQGAEANGAEGSSSDDLLPDADTITN 893
            |..||.|..:|: .:||.||:      ||..:||..|.|         :|.:|.:..|:.....:
  Rat   408 SCFILIPYLQTLGGVPTQASL------PLEATSSQIICP---------DGVTSANFYPETWVYMH 457

  Fly   894 VSGFLSSQQLHHLIELFEREQITLDILAEMGHDDLKQVGVSAYGFRHKILKGIAQLRSTTGIGNN 958
            .|                              .|..||.|||                       
  Rat   458 PS------------------------------QDFIQVPVSA----------------------- 469

  Fly   959 VNLCTLLVDLLPDDKEFVAVEEEMQATIREHRDNGQAGGYFTRYNIIRVQKVQNRKLWERYAHRR 1023
                        :||.:..:......|:.|.           :|.|:::.:|||:.|||:|..::
  Rat   470 ------------EDKSYRIIYNLFHKTVPEF-----------KYRILQILRVQNQFLWEKYKRKK 511

  Fly  1024 QEIAEENFLQS------NERMLFHGS--PFINAIVQRGFDER----HAYIGGMFGAGIYFAEHSS 1076
            :.:   |...|      |||.||||:  ..::.|.:..||.|    ||   .|||.|.|||:.:|
  Rat   512 EYM---NRKMSGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHA---TMFGQGSYFAKKAS 570

  Fly  1077 KSNQYVYGIGGGIGCPSHKDKSCYVCPRQLLLCRVALGKSFLQYSAMKMAHAPPGHHSVVGRPSA 1141
            .|:.:......|:              ..:.|.:|..|:..:....|:  ..||.:...|    .
  Rat   571 YSHNFSKKSSKGV--------------HFMFLAKVLTGRYTMGSHGMR--RPPPVNPGSV----T 615

  Fly  1142 GGLH------FAE---YVVYRGEQSYPEYLITYQIV 1168
            ..|:      |.|   :|::..:||||.::|.|:.|
  Rat   616 SDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEV 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125
ANK repeat 59..87 CDD:293786
Ank_2 61..153 CDD:289560
ANK repeat 89..120 CDD:293786
ANK repeat 122..153 CDD:293786
ANK 202..316 CDD:238125
ANK repeat 212..240 CDD:293786
Ank_2 214..306 CDD:289560
ANK repeat 242..273 CDD:293786
ANK repeat 275..306 CDD:293786
ANK 361..478 CDD:238125
ANK repeat 363..396 CDD:293786
Ank_2 367..459 CDD:289560
ANK 393..573 CDD:238125
ANK repeat 398..429 CDD:293786
ANK repeat 431..459 CDD:293786
ANK repeat 483..515 CDD:293786
Ank_4 486..540 CDD:290365
ANK 512..637 CDD:238125
ANK repeat 522..550 CDD:293786
Ank_2 524..616 CDD:289560
ANK repeat 552..583 CDD:293786
ANK repeat 585..610 CDD:293786
ANK repeat 638..668 CDD:293786
Ank_4 641..693 CDD:290365
ANK 665..779 CDD:238125
ANK repeat 672..703 CDD:293786
Ank_2 677..769 CDD:289560
ANK repeat 705..736 CDD:293786
ANK repeat 738..769 CDD:293786
SAM_tankyrase1,2 887..952 CDD:188923 7/64 (11%)
SAM 890..952 CDD:197735 7/61 (11%)
tankyrase_like 948..1170 CDD:238718 56/242 (23%)
PARP 961..1165 CDD:279038 54/224 (24%)
TiparpNP_001101149.2 WWE 348..401 CDD:397111
TCCD_inducible_PARP_like 529..648 CDD:238719 36/141 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.