DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and Ankrd2

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_001101059.1 Gene:Ankrd2 / 309374 RGDID:1305104 Length:328 Species:Rattus norvegicus


Alignment Length:283 Identity:80/283 - (28%)
Similarity:117/283 - (41%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 TPLHLAAELLHYDAMEVLLKQGAKVNALDSL-GQTPLHRCARDEQAVRLLLSYAADTNIVSL--- 461
            ||...:.::|   .:|...:.|.:..||..: ||..:.:.:.|.:  |.::......|::.|   
  Rat    31 TPGKTSMDML---VLEDEKRLGVQSPALQKVKGQERVRKTSLDLR--REIIDVGGIQNLIELRKK 90

  Fly   462 ------EGLTAAQLASDSVLKLLKNPPDSETHLLEAAKAGDLDTVRRIVLNNPISVNCRDLDGRH 520
                  :.|.|||...... :.:..|.|.|| .|:||..|.:..:.:.:.:...:..|   |...
  Rat    91 RKQKKRDALAAAQEPPPEP-EEITGPVDEET-FLKAAVEGKIKVIDKYLADGGSADTC---DEFR 150

  Fly   521 STPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLW 585
            .|.||.|:....:.:::.|||:||.|...|:.....:|.||..||.||.:||...|||.:|.|..
  Rat   151 RTALHRASLEGHMEILEKLLENGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSRGANTDVRDKL 215

  Fly   586 KFTPLHEAAAKG---------------------------------KYDICKLLLKHGADPMKKNR 617
            ..||||.|...|                                 :|.|.||||.||||.|.||.
  Rat   216 LSTPLHVAVRTGHVEIVEHFLSLGLDINAKDREGDSALHDAVRLNRYKIIKLLLLHGADMMAKNM 280

  Fly   618 DGATPADLVKESDHDVAELLRGP 640
            .|.||.|||:....|....|..|
  Rat   281 AGKTPTDLVQLWQADTRHALEHP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125
ANK repeat 59..87 CDD:293786
Ank_2 61..153 CDD:289560
ANK repeat 89..120 CDD:293786
ANK repeat 122..153 CDD:293786
ANK 202..316 CDD:238125
ANK repeat 212..240 CDD:293786
Ank_2 214..306 CDD:289560
ANK repeat 242..273 CDD:293786
ANK repeat 275..306 CDD:293786
ANK 361..478 CDD:238125 17/86 (20%)
ANK repeat 363..396 CDD:293786
Ank_2 367..459 CDD:289560 12/58 (21%)
ANK 393..573 CDD:238125 46/181 (25%)
ANK repeat 398..429 CDD:293786 6/27 (22%)
ANK repeat 431..459 CDD:293786 5/28 (18%)
ANK repeat 483..515 CDD:293786 8/31 (26%)
Ank_4 486..540 CDD:290365 11/53 (21%)
ANK 512..637 CDD:238125 53/157 (34%)
ANK repeat 522..550 CDD:293786 10/27 (37%)
Ank_2 524..616 CDD:289560 41/124 (33%)
ANK repeat 552..583 CDD:293786 13/30 (43%)
ANK repeat 585..610 CDD:293786 13/57 (23%)
ANK repeat 638..668 CDD:293786 1/3 (33%)
Ank_4 641..693 CDD:290365 80/283 (28%)
ANK 665..779 CDD:238125
ANK repeat 672..703 CDD:293786
Ank_2 677..769 CDD:289560
ANK repeat 705..736 CDD:293786
ANK repeat 738..769 CDD:293786
SAM_tankyrase1,2 887..952 CDD:188923
SAM 890..952 CDD:197735
tankyrase_like 948..1170 CDD:238718
PARP 961..1165 CDD:279038
Ankrd2NP_001101059.1 Ank_4 120..170 CDD:290365 11/53 (21%)
ANK 144..269 CDD:238125 37/127 (29%)
ANK repeat 151..180 CDD:293786 10/28 (36%)
Ank_2 154..246 CDD:289560 30/91 (33%)
ANK repeat 184..213 CDD:293786 13/28 (46%)
ANK repeat 215..246 CDD:293786 6/30 (20%)
Ank_5 231..289 CDD:290568 17/57 (30%)
ANK repeat 248..279 CDD:293786 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.