Sequence 1: | NP_001262963.1 | Gene: | Tnks / 43095 | FlyBaseID: | FBgn0027508 | Length: | 1520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031760115.1 | Gene: | LOC101732603 / 101732603 | -ID: | - | Length: | 554 | Species: | Xenopus tropicalis |
Alignment Length: | 135 | Identity: | 26/135 - (19%) |
---|---|---|---|
Similarity: | 51/135 - (37%) | Gaps: | 21/135 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1209 QQQQQQPQPQQQQKAPLPLPPPQQQTSAPVAKRRPK---------HAKPSLQLQYQPYQPQHHPV 1264
Fly 1265 VATAAAVTTTQPSPAGVFAHSNNNNNTSSGNVNNNNNDMSPVSNSNSYSSVDTNQ--TLLNSLAN 1327
Fly 1328 QQRNH 1332 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1115202at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |