DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tnks and Ankdd1a

DIOPT Version :9

Sequence 1:NP_001262963.1 Gene:Tnks / 43095 FlyBaseID:FBgn0027508 Length:1520 Species:Drosophila melanogaster
Sequence 2:XP_006243362.1 Gene:Ankdd1a / 100362785 RGDID:1586052 Length:509 Species:Rattus norvegicus


Alignment Length:681 Identity:155/681 - (22%)
Similarity:222/681 - (32%) Gaps:266/681 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PL-RELFEACKTGEIAKVKKLITPQ-TVNARDTAGRKSTPLHFAAGYGRREVVEFLLNSGASIQA 85
            || |:|.||.:..::.|:|:|:..: .:.||:..||  ..||:|||.|..:.|..||..||::..
  Rat    14 PLERQLHEASRNNQVGKMKELLGKRVNIRARNHVGR--VALHWAAGGGHEQAVRLLLEHGAAVDD 76

  Fly    86 CDEGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHT 150
            .|..|:..|.....|||.::|::|:.|||..:.......|.||.||.||.:.|...:::      
  Rat    77 VDSFGMTALLLSAWFGHLQIVQILVNAGARVHWESKDGLTLLHCAAQKGHMPVLAFIME------ 135

  Fly   151 IRNSEQKTPLELADEATRPVLTGEYRKDELLEAARSGAEDRLLALLTPLNVNCHASDGRRSTPLH 215
                      :|.|.|              |:.|     |:|               ||  |..|
  Rat   136 ----------DLEDVA--------------LDHA-----DKL---------------GR--TAFH 154

  Fly   216 LAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPL 280
            .||.:.::..::.|:.:|.|...|||.|...||.|.|.||.||.:.|:..|              
  Rat   155 RAAEHGQLDALDFLVGSGCDHSVKDKDGNTALHLAASQGHMDVLQRLVDIG-------------- 205

  Fly   281 HEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACRKCDVSR 345
                                                                  ||         
  Rat   206 ------------------------------------------------------LD--------- 207

  Fly   346 AKKLVCAEIVNFVHPYTGDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLHLAAELL 410
                                                          |.|:|...||.||.|||.:
  Rat   208 ----------------------------------------------LEEQNTEGLTALHAAAEGI 226

  Fly   411 HYDAMEVLLKQGAKVNALDSLGQTPLHRCAR--DEQAVRLLLSYAADTNIVSLEGLTAAQLASDS 473
            |.|.:..||..|:.||||...|.:..|..||  .|...|.|:.....|::...:|.|...||   
  Rat   227 HADCVVFLLSAGSNVNALTQKGLSCFHYAARSGSEDMSRALVKAGGRTDVADKQGTTPMHLA--- 288

  Fly   474 VLKLLKNPPDSETHLLEAAKAGDLDTVRRIVLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQF 538
               :..|.|.....|:||  ..|||.                :|.|..||||.||......|.:.
  Rat   289 ---VKHNFPGLVQLLIEA--HSDLDA----------------MDIRQQTPLHLAAEHAWQDVAEM 332

  Fly   539 LLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVK----------HGANVNVSDL--------- 584
            ||..||::...||.|...|..|....|..:.::::|          |.:..:.|||         
  Rat   333 LLIAGADLSLRDKQGKTALAVAARSNHISLVDMIIKADRFYRWEKDHLSCRDDSDLSRKNLTFKQ 397

  Fly   585 --------------------------------WKFTPLHEAAAKGKYDICK----------LLLK 607
                                            |:||..|..|.:.::...:          |:..
  Rat   398 DHRQETQQLRSVLWRLASRYLRPNEWKKLAYSWQFTEAHVCAIEQQWTGTRSYQEHGHRMLLIWL 462

  Fly   608 HGADPMKKNRDGATPADLVKESDHDVAELLR 638
            ||.....||...|...||:.....|:||..|
  Rat   463 HGVATAGKNPSKALFEDLMAIGRRDLAESTR 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TnksNP_001262963.1 ANK 49..163 CDD:238125 34/113 (30%)
ANK repeat 59..87 CDD:293786 11/27 (41%)
Ank_2 61..153 CDD:289560 30/91 (33%)
ANK repeat 89..120 CDD:293786 10/30 (33%)
ANK repeat 122..153 CDD:293786 8/30 (27%)
ANK 202..316 CDD:238125 23/113 (20%)
ANK repeat 212..240 CDD:293786 7/27 (26%)
Ank_2 214..306 CDD:289560 20/91 (22%)
ANK repeat 242..273 CDD:293786 11/30 (37%)
ANK repeat 275..306 CDD:293786 0/30 (0%)
ANK 361..478 CDD:238125 31/118 (26%)
ANK repeat 363..396 CDD:293786 2/32 (6%)
Ank_2 367..459 CDD:289560 27/93 (29%)
ANK 393..573 CDD:238125 57/181 (31%)
ANK repeat 398..429 CDD:293786 15/30 (50%)
ANK repeat 431..459 CDD:293786 8/29 (28%)
ANK repeat 483..515 CDD:293786 6/31 (19%)
Ank_4 486..540 CDD:290365 15/53 (28%)
ANK 512..637 CDD:238125 40/185 (22%)
ANK repeat 522..550 CDD:293786 11/27 (41%)
Ank_2 524..616 CDD:289560 28/152 (18%)
ANK repeat 552..583 CDD:293786 6/40 (15%)
ANK repeat 585..610 CDD:293786 7/34 (21%)
ANK repeat 638..668 CDD:293786 1/1 (100%)
Ank_4 641..693 CDD:290365
ANK 665..779 CDD:238125
ANK repeat 672..703 CDD:293786
Ank_2 677..769 CDD:289560
ANK repeat 705..736 CDD:293786
ANK repeat 738..769 CDD:293786
SAM_tankyrase1,2 887..952 CDD:188923
SAM 890..952 CDD:197735
tankyrase_like 948..1170 CDD:238718
PARP 961..1165 CDD:279038
Ankdd1aXP_006243362.1 Ank_2 19..108 CDD:289560 32/90 (36%)
ANK repeat 19..45 CDD:293786 7/25 (28%)
ANK 43..169 CDD:238125 47/179 (26%)
ANK repeat 47..78 CDD:293786 13/32 (41%)
ANK repeat 80..110 CDD:293786 10/29 (34%)
ANK 112..235 CDD:238125 52/297 (18%)
ANK repeat 113..146 CDD:293786 13/67 (19%)
Ank_4 114..169 CDD:290365 21/106 (20%)
ANK repeat 149..179 CDD:293786 9/31 (29%)
Ank_2 153..243 CDD:289560 38/212 (18%)
ANK 178..301 CDD:238125 49/251 (20%)
ANK repeat 181..212 CDD:293786 15/153 (10%)
ANK repeat 214..245 CDD:293786 15/30 (50%)
ANK 242..367 CDD:238125 42/148 (28%)
ANK repeat 247..278 CDD:293786 8/30 (27%)
Ank_2 252..344 CDD:289560 32/115 (28%)
ANK repeat 280..311 CDD:293786 12/54 (22%)
ANK repeat 313..344 CDD:293786 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.