DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG42526

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:259 Identity:57/259 - (22%)
Similarity:97/259 - (37%) Gaps:70/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRV 93
            ||..||...:.:..::::.:.|:..|    ..|..:|..........:.|..:||:||   .|..
  Fly     4 FDALLIASVKRNVSIFEKYHTRYDRK----QAWIAVAQACQKSVEYCQIRWKSLRDRY---VRET 61

  Fly    94 ENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMS---------VKEEDEETYEVDDCRSDSNGHM 149
            :...:|:|: ...|:.|.||.:|||.||....:.         |.....::...|:...:.||..
  Fly    62 QKPAATRSN-IRKFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNGIT 125

  Fly   150 NSIKDE--LEDDSEIFDCEQALPVTTVLGIPLNNSDE--ANKSQRSTNGEMP-------NGKGYN 203
            ....||  :|...|    |:.|..|.      |:|.|  :..|..:...|:|       ||:|  
  Fly   126 EFQPDEFIIEYKGE----EEYLSETD------NSSAEFISEDSACNIGSELPYVTKPSFNGEG-- 178

  Fly   204 HFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRR-------------VDDSLSI 254
                    :.|.|.:::   .::|.:.|      .|.|.|::.:             ||||..|
  Fly   179 --------QSQTQAKFM---SVMNLIES------ALKDKPAEPQDPFYKYLESILTGVDDSTRI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/84 (23%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.