DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and ABF2

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_013788.1 Gene:ABF2 / 855094 SGDID:S000004676 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:27/172 - (15%)
Similarity:54/172 - (31%) Gaps:67/172 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EKRRVENGLSTQSSQWPLFESLQFLGDH----------IRPRRSFKNMSVKEEDEETYEVDDCRS 143
            ::.::.|.|..|..:.|......:|.||          :||....|   :..|..:..|.|    
Yeast    30 KRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISK---IAGEKWQNLEAD---- 87

  Fly   144 DSNGHMNSIKDE-LEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAE 207
                    ||:: :.:..:::                   .|..|:::..:.::|..|....|.:
Yeast    88 --------IKEKYISERKKLY-------------------SEYQKAKKEFDEKLPPKKPAGPFIK 125

  Fly   208 SYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVD 249
                                  .:|:..||....||.|.::|
Yeast   126 ----------------------YANEVRSQVFAQHPDKSQLD 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 7/38 (18%)
ABF2NP_013788.1 NHP6B 1..183 CDD:227935 27/172 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.