DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Tfam

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_112616.2 Gene:Tfam / 83474 RGDID:620682 Length:244 Species:Rattus norvegicus


Alignment Length:222 Identity:41/222 - (18%)
Similarity:77/222 - (34%) Gaps:79/222 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QLPKGRGR-PRATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQI--AHKLGYDA 72
            ||||.:.: |.|..::       |||:                    :|.:|.::  |.|..|:|
  Rat    63 QLPKFKAKHPDAKVSE-------LIRK--------------------IAAMWRELPEAEKKVYEA 100

  Fly    73 TSIRERMTTLRNRYNIEKRRVEN-----------GLSTQSSQWPLFESLQ-------FLGDHIRP 119
                    ..:..:.:.|..|..           ||..::.|..|.:..|       .||...||
  Rat   101 --------DFKAEWKVYKEAVSKYKEQLTPSQLMGLEKEARQKRLKKKAQIKRRELILLGKPKRP 157

  Fly   120 RRSFKNMSVKEEDEETYE---------VDDC-----RSDSNGHMNSIKDE-LEDDSEIFDCEQAL 169
            |.:: |:.|.|..:|..:         |:..     ..:...::...||: :..|:|:...|:.:
  Rat   158 RSAY-NIYVSESFQEAKDESAQGKLKLVNQAWKNLSHDEKQAYIQLAKDDRIRYDNEMKSWEEQM 221

  Fly   170 PVTTVLGIPLNNSDEANKSQRSTNGEM 196
                   ..:..||...:|.:...|::
  Rat   222 -------AEVGRSDLIRRSVKRPPGDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 18/104 (17%)
TfamNP_112616.2 NHP6B <46..215 CDD:227935 36/187 (19%)
HMG_box 49..116 CDD:395407 17/87 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..244 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.