DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and TFAM

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens


Alignment Length:139 Identity:33/139 - (23%)
Similarity:62/139 - (44%) Gaps:29/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YRSHPVLYDRSNKRFKDKLYVAHIW---EQIAHK-LGYDATSIRERMTTL------RNRYNI--- 88
            ||:...:|.....|||::|..:.|.   ::|..| |...|.:.::.:|.|      |:.||:   
Human   103 YRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVA 167

  Fly    89 EKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIK 153
            |:.:...|.|.|       |.|:.:      :.::||:|  :.::|.| :...:.|...:.|.:|
Human   168 ERFQEAKGDSPQ-------EKLKTV------KENWKNLS--DSEKELY-IQHAKEDETRYHNEMK 216

  Fly   154 DELEDDSEI 162
            ...|...|:
Human   217 SWEEQMIEV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/93 (25%)
TFAMNP_003192.1 HMG_box 50..117 CDD:395407 3/13 (23%)
HMGB-UBF_HMG-box 155..216 CDD:238686 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.