DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Hmgb4

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001102933.1 Gene:Hmgb4 / 685271 RGDID:1596426 Length:181 Species:Rattus norvegicus


Alignment Length:190 Identity:38/190 - (20%)
Similarity:59/190 - (31%) Gaps:60/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENLSHLYPPQLPKGRGRPRATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIA 65
            |.|..:.:..|.|.       ||....||......::||       .:|..|.|      :|.||
  Rat    20 MINFRNKFKEQQPN-------TYLTFNEFSRRCSEKWRS-------ISKNEKAK------FEAIA 64

  Fly    66 HKLGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHI-RPRRSFKNMSV- 128
             ||  |....:|.|...     :.|||........:.:.|....|.|..||. :.::...|.:| 
  Rat    65 -KL--DKARYQEEMMNY-----VGKRRKRRKRDPLAPRKPPSSFLLFSLDHFAKLKQENPNWTVV 121

  Fly   129 -------------KEEDEETYE-----------------VDDCRSDSNGHMNSIKDELED 158
                         .:.|:..||                 :..|::.......|.|..|::
  Rat   122 QVAKAAGKMWSMITDVDKRPYEQKAAIMRAKYFQEREAYLSQCQNSKINLQGSSKSSLKE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 21/85 (25%)
Hmgb4NP_001102933.1 HMGB-UBF_HMG-box 9..75 CDD:238686 20/77 (26%)
HMG-box 93..158 CDD:238037 10/64 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.