DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Hmg20a

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_080088.1 Gene:Hmg20a / 66867 MGIID:1914117 Length:346 Species:Mus musculus


Alignment Length:288 Identity:59/288 - (20%)
Similarity:110/288 - (38%) Gaps:83/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SHLYPPQLPKGRGRPRATYAQTGEF--DLG---LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQI 64
            |.|..|:.|.|..   ||.....||  ||.   |::...|:.|  :.:.:|.:|        ||.
Mouse    29 SGLTHPEGPYGSA---ATSTTNPEFVEDLSQGQLLQSEASNAV--EGNEQRPED--------EQR 80

  Fly    65 AHKLGYDATSIRERMTTLRN------------RYNIEKR-------------RVENGLSTQSSQW 104
            :.:.|:  :..|:|...||:            |:..|:|             .:...|..:.|:.
Mouse    81 SKRGGW--SKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSKL 143

  Fly   105 PLFESLQFLGDHIRPR-------------RSFKNMSVKEEDEE---TYEVDDCRSDSNGHMNSIK 153
            |..|..::|.:..|.:             .::|..|.|.:|.:   ::..|..|..::.|..  :
Mouse   144 PPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEK--E 206

  Fly   154 DELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQ-RSTNGEMPNGKGYNHFAE--SYHRRHQN 215
            .|:::.| :||    :|:.|...:..:.:.||...| |.:|.|         |.|  :..::|..
Mouse   207 TEVKERS-VFD----IPIFTEEFLNHSKAREAELRQLRKSNME---------FEERNAALQKHVE 257

  Fly   216 QPEYIISSPIVNPMRSNKRGS---QHLD 240
            .....:....|:.::...|.:   |||:
Mouse   258 SMRTAVEKLEVDVIQERSRNTVLQQHLE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 20/109 (18%)
Hmg20aNP_080088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 23/97 (24%)
DUF5401 <76..312 CDD:375164 44/236 (19%)
HMGB-UBF_HMG-box 102..167 CDD:238686 9/64 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..210 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.