DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and UBTFL1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001137447.1 Gene:UBTFL1 / 642623 HGNCID:14533 Length:393 Species:Homo sapiens


Alignment Length:145 Identity:31/145 - (21%)
Similarity:53/145 - (36%) Gaps:55/145 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EFDLGLIREYRSHPVLYDRS-----NKRFKDKL---YVAHIWEQIA------------------- 65
            ||:..|.|....||.|..::     :||.::|:   :..:| |::.                   
Human   159 EFEEKLARFREEHPDLVQKAKKSSVSKRTQNKVQKKFQKNI-EEVRSLPKTDRFFKKVKFHGEPQ 222

  Fly    66 -------HKLGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSF 123
                   ||...|:.|.:|     ....::.:|.||.|     .:|......|  .||      |
Human   223 KPPMNGYHKFHQDSWSSKE-----MQHLSVRERMVEIG-----RRWQRIPQSQ--KDH------F 269

  Fly   124 KNMSVKEEDEETYEV 138
            |:.:  ||.::.|:|
Human   270 KSQA--EELQKQYKV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/118 (19%)
UBTFL1NP_001137447.1 HMGB-UBF_HMG-box 100..165 CDD:238686 2/5 (40%)
HMGB-UBF_HMG-box 223..285 CDD:238686 19/80 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.