DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and tox

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001243623.1 Gene:tox / 569666 ZFINID:ZDB-GENE-070912-181 Length:540 Species:Danio rerio


Alignment Length:188 Identity:40/188 - (21%)
Similarity:65/188 - (34%) Gaps:68/188 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PNGKGYNHFAES-YHRRHQNQ------PE-----------YIISSPIVNPMRSNKRG-------- 235
            |:..|.:|:::| |..::.::      ||           .:.:|| .....|||:.        
Zfish    17 PSRLGQSHYSDSPYCNKYDSENMFMSMPEPGQDFVPGNQFRVPASP-SQTQHSNKQAGGHWKRET 80

  Fly   236 SQHLDDH-------PSKRRVDDSLSISGYY-PTQP---LAPLPPAYAKFRGFGEFMCHSLC---- 285
            ..|.|.|       |.....|:..:|.... ||.|   ||.||.:.:     |.:  |.||    
Zfish    81 QTHTDGHRLTWQSYPVPSLGDEDFNIPPITPPTLPEHMLAHLPESES-----GTY--HPLCPPVS 138

  Fly   286 ------------DMPAATALRLVQK----FTREL-VQSSLRNEDS--GSKEKTDEVDP 324
                        |:|...:..::.:    .|..| |...:.|.||  |...:.|.:.|
Zfish   139 QNGLHPFHLQGMDLPGMLSPNMLSQDGSLLTNSLSVMQQMVNSDSRYGGHPQVDTLRP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
toxNP_001243623.1 HMG-box 289..>338 CDD:238037
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.