DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and hmgb3a

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001116308.1 Gene:hmgb3a / 561025 ZFINID:ZDB-GENE-050428-1 Length:213 Species:Danio rerio


Alignment Length:224 Identity:41/224 - (18%)
Similarity:86/224 - (38%) Gaps:59/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PQLPKGRGRPRATYAQTGEFDLGLIREYRSH----PVLYDRSNKRFKDKLYVAHIWEQIAHKLGY 70
            |:.|||:....|.:.||..      .|::..    ||.:...:||...:      |:.:..|   
Zfish     6 PRKPKGKMSAYAYFVQTCR------EEHKKKSPEIPVSFSEFSKRCSGR------WKAMTDK--- 55

  Fly    71 DATSIRERMTTLRNRYNIE----------KRRVENGLSTQSSQWPLFESLQFLGDHIRP--RRSF 123
            :.:...:.....:.||:.|          |::..|......|.:.||.|     :| ||  :..:
Zfish    56 EKSRFEDMAKQDKVRYDQEMMHYMPGKRGKKKDPNAPKRPPSGFFLFCS-----EH-RPQIKAQY 114

  Fly   124 KNMSVKEEDEETYEVDDCRSDSNGH-----MNSIKDELEDDSEIFDCE-QALPVTTVLGIPLNN- 181
            .::.:.:..::..|:.:..:|:|..     .|.:||:.:.|...:..: :|..|:..:|:|:.| 
Zfish   115 PSLGIGDVAKKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVADYKTKSKAGGVSMGMGMPMANC 179

  Fly   182 ---------------SDEANKSQRSTNGE 195
                           .||.::.:...:.|
Zfish   180 MPPKPMMKSNMDDEEDDEEDEEEEEDDDE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 17/98 (17%)
hmgb3aNP_001116308.1 HMG_box_2 7..78 CDD:286146 16/85 (19%)
HMG_box 92..159 CDD:278906 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.