DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and tox4a

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_001921001.2 Gene:tox4a / 559853 ZFINID:ZDB-GENE-070912-576 Length:685 Species:Danio rerio


Alignment Length:181 Identity:35/181 - (19%)
Similarity:61/181 - (33%) Gaps:57/181 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 VTTVLGIPLNNSDEAN-KSQRSTNGEMPNGK------GYNHFAESYHRRHQNQ------------ 216
            :::.||:.|.:|..:: .|..|...::|..:      |:|......|.....|            
Zfish   150 LSSTLGVDLGHSVGSHFASSSSMTIDVPINEMSHSLLGHNQLTTIDHSDLSAQLGLSLGGGSVSK 214

  Fly   217 -PEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGFGEFM 280
             |:..:|:   .|..|.....:.::|...|..:.||.::|...|.|...| ||...:..|.... 
Zfish   215 SPDQPLST---TPSPSGSLQDEDMEDFRQKTMLVDSFAVSEPSPAQISVP-PPVVRRVGGKPSM- 274

  Fly   281 CHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGS-------KEKTDEVDP 324
                  :|.||.                   |:|:       |:|.|..:|
Zfish   275 ------VPVATV-------------------DTGASLGVKKGKKKKDPNEP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
tox4aXP_001921001.2 PHA03369 <215..510 CDD:223061 24/116 (21%)
HMG-box 300..365 CDD:238037 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.