DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and tox3

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_005169075.1 Gene:tox3 / 555286 ZFINID:ZDB-GENE-090312-209 Length:587 Species:Danio rerio


Alignment Length:143 Identity:30/143 - (20%)
Similarity:50/143 - (34%) Gaps:48/143 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNP------MRSNKRGSQH 238
            ||::..|.:  ..||.:..|      .:::|.......|:.| .||..|      |.....||.:
Zfish    45 NNNNYMNMA--DANGALLAG------GDTFHTPSLGDEEFEI-PPITPPPETEPGMGLQDVGSPY 100

  Fly   239 --LDDHPSKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGFGEFMCHSLCDMPAATALRLVQKFTR 301
              |.|||:.:|.    |.:..:|.|.|                      ::|:.|..|.:.:.  
Zfish   101 PGLPDHPNPQRG----SFTPQFPPQSL----------------------ELPSITISRNMMEH-- 137

  Fly   302 ELVQSSLRNEDSG 314
               :..:.|..||
Zfish   138 ---EGQINNGHSG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
tox3XP_005169075.1 HMG-box 264..329 CDD:238037
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.