DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and hmg20b

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001018387.1 Gene:hmg20b / 553572 ZFINID:ZDB-GENE-030131-4258 Length:301 Species:Danio rerio


Alignment Length:295 Identity:63/295 - (21%)
Similarity:106/295 - (35%) Gaps:81/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENLSHLYPPQ---LPKGRGR-------PRATYAQTGEFDLGLIREY--RSHPVL-YDRSNKRFKD 53
            ||.|...|.:   .|||:.|       |:|.......| |...||:  ..||.| :....||...
Zfish    26 ENQSTSQPVKKRGWPKGKKRKKVLPNGPKAPVTGYVRF-LNERREHIRALHPDLPFPEITKRLGA 89

  Fly    54 KLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIR 118
            :      |.::|   .:|           :.||..|..|.:...:.:..::...|:.|.....::
Zfish    90 E------WSRLA---PHD-----------KQRYLDEAERDKMQYARELREYQKSEAYQITCAKVQ 134

  Fly   119 PRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSD 183
            .:|      :|.|:..:..::...|.|:|..||      |.:..||    :|:.|...:..|.:.
Zfish   135 DKR------IKREELTSVIINANSSGSSGFKNS------DFTARFD----VPIFTEEFLDQNKAR 183

  Fly   184 EAN-KSQRSTNGEM--PNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDH--P 243
            ||. :..|..|.|.  .|.....|.|:.:..:.:.:.|          :..::..:|.|..|  .
Zfish   184 EAELRRLRKANVEFEEQNAVLQKHIADMFSAKERLEAE----------LGQDELRTQALQRHLQA 238

  Fly   244 SKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGFGE 278
            .|:.:..||:         ..|||       |.||
Zfish   239 IKQTLVSSLA---------TVPLP-------GTGE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 16/87 (18%)
hmg20bNP_001018387.1 HMGB-UBF_HMG-box 53..118 CDD:238686 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.