DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Ubtfl1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001028965.1 Gene:Ubtfl1 / 546118 MGIID:3588290 Length:394 Species:Mus musculus


Alignment Length:229 Identity:46/229 - (20%)
Similarity:79/229 - (34%) Gaps:77/229 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DSNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTN----------GEMPN 198
            |:.| :.|.||.|    ::.:|.:.       .||.::|.|..|||...|          |||..
Mouse     5 DNQG-LWSEKDIL----KLLECMEH-------NIPSDDSREFKKSQADLNWSKVAFGLFSGEMCK 57

  Fly   199 GK----GYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYP 259
            .|    .||      .|:.:...|.:..:......:::|  ::.|.:||.:             |
Mouse    58 QKWMEISYN------LRKFRTLTELVQEAKFSFTKKTHK--NKILTEHPDR-------------P 101

  Fly   260 TQPLAPLPPAYAKF-----------------RGFGEFMCHSLCDMPAATALRLVQKFTRE----- 302
            .:||.    ||.:|                 ....:.:......:||....|.:..|.:|     
Mouse   102 KRPLT----AYLRFYKEQRAKYCQMYPKYSNAQLTKILAEKYRQLPAEIKQRYIMDFKKEKEDFQ 162

  Fly   303 --LVQSSLRNEDSGSKEKT--DEVDPVDQSSESQ 332
              :.|...|:..||..:|:  .:..|....::||
Mouse   163 KKMRQFKKRHPVSGHPKKSVVPQSHPTKVPTKSQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
Ubtfl1NP_001028965.1 HMGB-UBF_HMG-box 101..166 CDD:238686 11/68 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..197 8/30 (27%)
HMGB-UBF_HMG-box 226..288 CDD:238686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.