DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Adf1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:107/245 - (43%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRR 92
            :|||.||...:.:||:||||:..:|..:..|..|:|||..||.......:|..:||:::..|.: 
  Fly    11 QFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMK- 74

  Fly    93 VENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELE 157
                 ..|.|:|..|:.:|||.|.||..|...             :..|   :||..::  :::.
  Fly    75 -----LCQESRWRYFKQMQFLVDSIRQYRESL-------------LGKC---ANGSQSA--NQVA 116

  Fly   158 DDSEIFDCEQALPVTTVLGIPLNNSDEANKSQR----------STNGEMPNGKGYN---HFAESY 209
            |.|:....:|. .|..:...|.|.|  |..|.:          :::.::....|.:   :|.|..
  Fly   117 DPSQQQQAQQQ-TVVDIFAQPFNGS--ATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPP 178

  Fly   210 HRRHQNQPEYIISSPIVNPMR---SNKRGSQHLDDHPSKRRVDDSLSISG 256
            .:|.:::.|:  |..::|.::   :|...:...:|......|.|.|:..|
  Fly   179 LKRERSEEEH--SDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 28/84 (33%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.