DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG3919

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:267 Identity:59/267 - (22%)
Similarity:100/267 - (37%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQW 104
            ||.||||.:..:..|..|.:.|::|::::.....|.:||...:|:.| ....::.:|.:|    :
  Fly    28 HPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSY-ARSIKLHHGANT----Y 87

  Fly   105 PLFESLQFLGDHIRP--------RRSFKNMSVKEEDE-------------------------ETY 136
            .|...|:||..||.|        ||| :....:|.||                         ::.
  Fly    88 YLNSELKFLQKHITPGVPVPLRGRRS-RPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSR 151

  Fly   137 EVDDCRSDSNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKG 201
            ...|..|.::.......:|   .|.|.|.|..:|..  :....::|::..|....|...:|    
  Fly   152 HSTDPASATDVEATQFNNE---PSSIMDFEDTVPAE--MRTESDSSEKEAKVGEITLYRVP---- 207

  Fly   202 YNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPS---KRRVDDSL--------SIS 255
            ...|.::..|..:..|........:..:|..   .:|::.|..   ||||.|.|        |.|
  Fly   208 LLEFPKTSTRCIEALPIMDFDDAFLQGLRPE---IKHMNFHQKLYFKRRVYDLLGEIFHSEQSAS 269

  Fly   256 GYYPTQP 262
            ..:|.||
  Fly   270 STHPAQP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 22/77 (29%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 21/76 (28%)
BESS 226..260 CDD:281011 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.