DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG9948

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster


Alignment Length:155 Identity:42/155 - (27%)
Similarity:68/155 - (43%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYV-AHIWEQIAHKLGYDATSIRERMTTLR 83
            |.:|.:...||..||.....:||||.||.....|.:.. ..||.:||..:|.|......|...|.
  Fly     2 RTSYKKNRPFDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLH 66

  Fly    84 NRYNIEKRRVENGLSTQSSQWPLFESLQFLGD-------HIRPRRSFKNMSVKEEDE-----ETY 136
            .::..|.||.:    |..|.||..|.|:||.:       ..:|:.:.:..:::.|..     :|:
  Fly    67 YQFRKEFRRAD----TSGSTWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETPVQFLWDTF 127

  Fly   137 EVDDCRSDSNGHMNSIKDELEDDSE 161
            |..|....|:..:  |::.:|:.||
  Fly   128 EDGDVPQQSSTFI--IEEVIEEPSE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 28/92 (30%)
CG9948NP_001261492.1 MADF 14..95 CDD:214738 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.