powered by:
Protein Alignment jigr1 and HmgD
DIOPT Version :9
Sequence 1: | NP_001097920.1 |
Gene: | jigr1 / 43093 |
FlyBaseID: | FBgn0039350 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163244.1 |
Gene: | HmgD / 37481 |
FlyBaseID: | FBgn0004362 |
Length: | 112 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 20/43 - (46%) |
Gaps: | 2/43 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 RLVQKFTRELVQSSLRNEDSGSKEKTDEVDPVDQSSESQEEDE 336
|.|::| |....|......|:|::......|.:.|:.:|.||
Fly 65 RAVKEF--EANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDE 105
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jigr1 | NP_001097920.1 |
MADF |
33..118 |
CDD:214738 |
|
HmgD | NP_001163244.1 |
HMGB-UBF_HMG-box |
5..68 |
CDD:238686 |
1/2 (50%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.