Sequence 1: | NP_001097920.1 | Gene: | jigr1 / 43093 | FlyBaseID: | FBgn0039350 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611558.2 | Gene: | hng1 / 37412 | FlyBaseID: | FBgn0034599 | Length: | 315 | Species: | Drosophila melanogaster |
Alignment Length: | 241 | Identity: | 50/241 - (20%) |
---|---|---|---|
Similarity: | 82/241 - (34%) | Gaps: | 72/241 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 DLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVE 94
Fly 95 NGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMS------------------------------VK 129
Fly 130 EEDEETYEVDDCRSDSNGHMNS-------------IKDELEDDSEIFD-------CEQALPVTTV 174
Fly 175 ---LGIP----------LNNSD---------EANKSQRSTNGEMPN 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jigr1 | NP_001097920.1 | MADF | 33..118 | CDD:214738 | 24/84 (29%) |
hng1 | NP_611558.2 | MADF | 15..98 | CDD:214738 | 23/82 (28%) |
BESS | 264..298 | CDD:281011 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45438479 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |