DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and hng1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:241 Identity:50/241 - (20%)
Similarity:82/241 - (34%) Gaps:72/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVE 94
            |:.||:..|..|.|||.....|:........|.::|..|....:..|.|.|.||:||:.|.::..
  Fly    12 DILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKR 76

  Fly    95 NGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMS------------------------------VK 129
            ...|.:......|..:.||.|.:|.||..:...                              ::
  Fly    77 LHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLIE 141

  Fly   130 EEDEETYEVDDCRSDSNGHMNS-------------IKDELEDDSEIFD-------CEQALPVTTV 174
            |:....|:..:.:.|.:..:.|             ..|..|.:.|.||       |||.:.|.|:
  Fly   142 EQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTI 206

  Fly   175 ---LGIP----------LNNSD---------EANKSQRSTNGEMPN 198
               :..|          .|::|         .||:.:..:..|:||
  Fly   207 HPEIAAPNATSAPEPIESNHADLNYLVCMPPNANQEREHSAPELPN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 24/84 (29%)
hng1NP_611558.2 MADF 15..98 CDD:214738 23/82 (28%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.