DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Hmg-2

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_611553.1 Gene:Hmg-2 / 37407 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster


Alignment Length:268 Identity:55/268 - (20%)
Similarity:89/268 - (33%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RRVENGLSTQSSQWPLFESLQFLGD--HIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIK 153
            ||.|  |..:..|....|..:.:|:  |..|          ||.:..| ::....|...:...::
  Fly    90 RREE--LRREQPQRTALEHTRIIGEEWHQLP----------EERKLPY-IEAAAKDKAIYQEQLQ 141

  Fly   154 DELEDDSEIF--DCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQ 216
            ..|::..||.  :..:|...|.:.|.|         .:::..||...||.....|:         
  Fly   142 MFLKEHPEIVANELAKAKKATKLDGSP---------KEKTPKGESALGKAKKTKAK--------- 188

  Fly   217 PEYIISSPIVNPMRSNKRGSQHLDDHP--SKRRVDDSLSISGYYPTQPLAP-------LPPAYAK 272
                   |:       ||.|:..||.|  ..:|......     ||.|.||       :|||...
  Fly   189 -------PV-------KRQSEDPDDVPLAKVKRAQTPPP-----PTPPAAPVQPPPSSVPPATPA 234

  Fly   273 FRGF---------GEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGSKEKTDEVDPVDQS 328
            .|..         .||:.|   :......||.::|...:|.|.:...|......|......:.:.
  Fly   235 PRPLQPGEIPIYTNEFIEH---NRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGEV 296

  Fly   329 SESQEEDE 336
            :|..||::
  Fly   297 TELMEENQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 8/28 (29%)
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.