DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Tox

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001102124.1 Gene:Tox / 362481 RGDID:1310455 Length:525 Species:Rattus norvegicus


Alignment Length:472 Identity:78/472 - (16%)
Similarity:134/472 - (28%) Gaps:175/472 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLSHLYPPQLPKGRGRPRATYAQTGEFDLGLIREYRS--HPVLYDRSNKRFKDKLYVAHIWEQIA 65
            |:..:.||.||.      .:.....|.:.|    |.|  ||:.::.........:.:..|  .::
  Rat    69 NIPPITPPSLPD------HSLVHLNEVESG----YHSLCHPMNHNGLLPFHPQNMDLPEI--TVS 121

  Fly    66 HKLGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGD--HIRPRRSFK---- 124
            :.||.|.|.:...::.:        :.:.|....|.|..|...:::..|.  .:|.:.|..    
  Rat   122 NMLGQDGTLLSNSISVM--------QEIGNAEGAQYSSHPQLAAMRPRGQPTDLRQQASMMQHGQ 178

  Fly   125 ---------------NMSVKEEDEETYEVDDCRSDSNGHMNSI-KDELEDDSEIFDCEQALPVTT 173
                           ||........:......:|.:....:|: :||.||.|:|...|:. |.:.
  Rat   179 LTTINQSQLSAQLGLNMGGTNVPHNSPSPPGSKSATPSPSSSVHEDECEDTSKINGGEKR-PASD 242

  Fly   174 VLGIPLNNSDEANK------------------SQRSTNGEMPN---------------GKG---- 201
            :...|.....:..|                  :|.:..|:.||               |.|    
  Rat   243 MGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQK 307

  Fly   202 --YNHFAESYHRRHQNQ------------------------PEYIISSPIVNPMRSNKRGSQHLD 240
              |....|:..:.:..|                        |:.:.|.|.|....|....:.:|.
  Rat   308 QVYKKKTEAAKKEYLKQLAAYRASLVSKSYNDPVDVKTSQPPQLVNSKPSVFHGPSQAHSALYLS 372

  Fly   241 D---------------HPSKRR-----------VDDSLSISGYYPTQPLAPLPPAYAKF------ 273
            .               |||..|           |..|::.....|..||...||.:...      
  Rat   373 SHYHQQPGMTPQLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPPLQISPPLHQHLSMQQHQ 437

  Fly   274 -------------------------RGFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDS 313
                                     :||.....:.....|.:||.::|.: ..|.|:|..||...
  Rat   438 PLVQQPLASQLPMQVQTALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQ-AMEYVRSGCRNPPP 501

  Fly   314 GSKEKTDEVDPVDQSSE 330
                     .|||.|::
  Rat   502 ---------QPVDWSTD 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 14/88 (16%)
ToxNP_001102124.1 NHP6B <257..>360 CDD:227935 13/102 (13%)
HMG-box 261..>310 CDD:238037 6/48 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.