DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG7745

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:391 Identity:73/391 - (18%)
Similarity:121/391 - (30%) Gaps:150/391 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DLGLIREYRSHPVLYDRSNKRFKDKLYV------------AHIWEQIAHKLGYDATSIRERMTTL 82
            |..||.|...|.|:|:|      .|.|:            ...|:.||.||..|..:.::|...|
  Fly     3 DEQLIDEVAQHGVIYNR------QKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYL 61

  Fly    83 RNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNM--------SVKEEDEETYEVD 139
            |.||..::::.:..:....|: |..|.::||..||:||:|::::        |........|:||
  Fly    62 RERYVSQRKQGDPPVYEHLSR-PYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVD 125

  Fly   140 DCRSDSNGHMNSIKD-------------------------------------ELEDDSEIFDC-- 165
                .|||.|.::..                                     ::|.|....|.  
  Fly   126 ----KSNGSMKNVSQFGSSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEADQVFRDFAA 186

  Fly   166 ----------------EQALPVTTVL--------------GIPLNNSDEANKSQRSTNGEMPNGK 200
                            :||..|..|:              .:.:|.:..:..|..||:..|    
  Fly   187 AVASQQLQHISQSQMQQQAAAVAAVMADSSQGYQDQYKDGSVGMNGAQNSAGSLTSTSSSM---- 247

  Fly   201 GYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPTQPLAP 265
                                 .||:.:|::....||.|......:::...........|... ..
  Fly   248 ---------------------KSPLSSPLQGIGAGSHHPQQQTQQQQQQQQQQAQQQSPASE-QQ 290

  Fly   266 LPPAYAKFRGFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGSKEKTDEVDPVDQSSE 330
            ||            :.||   ..:||...:....|.::.||.:.|...         |.:|.||.
  Fly   291 LP------------VVHS---SSSATGASIGNSSTLQMQQSHVYNPKG---------DGLDSSSS 331

  Fly   331 S 331
            |
  Fly   332 S 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 26/96 (27%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 26/97 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.