DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG10949

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:356 Identity:76/356 - (21%)
Similarity:113/356 - (31%) Gaps:120/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAH-IWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENG 96
            ||...:||||||||...|....|...: .|.:|:..|.........|...||:|:..|.|..:..
  Fly   141 LIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRSHQIN 205

  Fly    97 LSTQSSQWPLFESLQFLGDHIR----------------PRRSFKNMSVK----------EEDEET 135
            .||..: |..|..|.|||.|.|                |:..  |.|.|          ...|:.
  Fly   206 QSTPIT-WRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAG--NPSGKTSKQPEGMVISSGEQI 267

  Fly   136 YEVDDCRSDSNGHMNSIKDELEDDSE---------IFDCEQALPVTTVLGIPLNNSDEANKSQRS 191
            :..|...|..|       |:||||.|         :.:.|||.|...:|.......|.....|..
  Fly   268 WGADYPYSTDN-------DDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQ 325

  Fly   192 TNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISG 256
            .....|                ....|.|.:...|||:                  |::|.|:.|
  Fly   326 VTTTTP----------------ATSEEIIHTIARVNPV------------------VEESSSLPG 356

  Fly   257 YYPTQPLAPLPPAYAKFRGFGEFMCHSLCDMPAATA---LRLVQKFTRELVQSSLRNEDSGSKEK 318
                   ..:|.|             ::.|....|.   :..|.:.:||| |:.:.:|....:|:
  Fly   357 -------DSVPSA-------------AISDKLLTTVIANMETVLQQSREL-QAQIHHEQEQEREQ 400

  Fly   319 ----------------TDEVDPVDQSSESQE 333
                            .|.:.|.:::|..::
  Fly   401 RSTQPANSLLAKAQMLLDGLSPSERASAERK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 30/85 (35%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 30/85 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.