DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and brwl

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster


Alignment Length:297 Identity:52/297 - (17%)
Similarity:96/297 - (32%) Gaps:79/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GRGRPRATYAQTG-------EFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDA 72
            |.|...|:...|.       :|::..:...|:|..|||:....::::......|..|:.:.....
  Fly    36 GSGTAGASIGSTNRVMQADEDFNIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESV 100

  Fly    73 TSIRERMTTLR---NRYNIEKRRVENGLSTQSSQWPLFESLQFL--------------------- 113
            ...:||...||   :||    .:.::|...|...:.|.|.:.||                     
  Fly   101 IHCKERWRNLRACLSRY----IKQQSGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLY 161

  Fly   114 ---GDHIRPRRSFKNMSVKEEDEETY----EVDDCRSDSNGHMNSIKDELE--------DDSEIF 163
               ..|::.:....:.::...:|..|    .:::..::::.|.....:.||        ||.|..
  Fly   162 QMSQQHLQHQPFLLHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETI 226

  Fly   164 DCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVN- 227
            |.... .||..||  :|.:     |...|......|.|.|..|.|......:...:|....:.. 
  Fly   227 DAFDP-AVTNTLG--MNRT-----SSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAET 283

  Fly   228 ---------------PMRSNKRGSQH-----LDDHPS 244
                           |:..:.....|     :|.||:
  Fly   284 GSQLIYSDGGHGTPPPLHYHPHSHPHPLTLSMDHHPA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 20/111 (18%)
brwlNP_609298.1 MADF 60..145 CDD:214738 19/88 (22%)
BESS 356..389 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.