DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG11723

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:320 Identity:73/320 - (22%)
Similarity:121/320 - (37%) Gaps:60/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIREYRSHPVLYDRS---NKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVE 94
            ||:|......|:|.:   :.|.:|   .|..|..:|..:..|.:..::|...:|:.|..|.|:::
  Fly     8 LIQEVSKRRCLWDTNMSISYRNQD---AALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQ 69

  Fly    95 NGLSTQSSQWPLFESLQFLGD--------HIRPRRSFKNMSVKEEDEETYEVD---DCRSDSNGH 148
            . ...:.|.||.|.||:|:..        ...|.....|....|..|.|..||   |...|::  
  Fly    70 Q-KRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLDLDND-- 131

  Fly   149 MNSIKDELEDDSEIFDCEQALPVTT-----VLGIPLNNSDE-ANKSQRSTNGEMPNGKGYNHFAE 207
             :|:..|:.:|  ||..|.::|..:     .|..||::|.. |::|.:..:..:|          
  Fly   132 -DSVDFEIIED--IFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLSPTLP---------- 183

  Fly   208 SYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPTQPLAPLPPAYAK 272
            .:..|||..        :..|...:|||.:. ...||    :|...::||......:...|....
  Fly   184 IHLPRHQQF--------LPRPPPPSKRGRRR-KTSPS----NDVPLLNGYASQASKSTTEPDLKN 235

  Fly   273 FRGFGEFMCHSLCDMPAATALRLVQ--KFTREL--VQSSLRNEDSGSKEKTDEVDPVDQS 328
            .......|..    ||...:|..:.  ||..|:  |...||.||..........|.:::|
  Fly   236 DSDLSFLMSM----MPHVKSLSAISNLKFRMEMARVLVELREEDQHMLAAAGPEDVLERS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/95 (24%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 23/86 (27%)
BESS 236..270 CDD:281011 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.