DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and hmg20a

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001082803.1 Gene:hmg20a / 326908 ZFINID:ZDB-GENE-030131-5107 Length:291 Species:Danio rerio


Alignment Length:277 Identity:55/277 - (19%)
Similarity:96/277 - (34%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IRERMTTLR-NRYNIEKRRVENGLSTQSSQWPLFESLQFLG-------------DHIRPRRSFKN 125
            :.||...|| .|.::....:...|..:.|:.|..|..::|.             :..:...::|:
Zfish    56 MNERREQLRAERPDVPFPEITRMLGNEWSKLPADEKQRYLDEADKDKERYMRELEQYQKTEAYKH 120

  Fly   126 MS--VKEEDEETYEVDDCRSDSNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKS 188
            .|  |:|:.:......|....:.|.....||....|..:||    :|:.|...:..:.:.||...
Zfish   121 FSRKVQEKQKGKRHRGDAGRQAPGESLHEKDLETKDRSVFD----IPIFTEEFLNHSKAREAEMR 181

  Fly   189 Q-RSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSL 252
            | |.||.|             |..|:....:::.|      |||   ..:.|:....:.|..:||
Zfish   182 QLRKTNME-------------YEERNAALQKHVES------MRS---AVERLEGDVLQERTRNSL 224

  Fly   253 SI-------SGYYPTQPLAPLPPAYAKFRGFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRN 310
            .:       |....:....|||       |.||        .|...::....|....|:.||.::
Zfish   225 LLQHLETLRSALTHSFSTVPLP-------GSGE--------TPTLESIDSYMKKLHSLILSSPQD 274

  Fly   311 EDSGSKEKTDEVDPVDQ 327
            .........|.|:.:|:
Zfish   275 HQHLISTVRDVVNRLDR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 10/56 (18%)
hmg20aNP_001082803.1 HMGB-UBF_HMG-box 45..110 CDD:238686 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.