powered by:
Protein Alignment jigr1 and CG32202
DIOPT Version :9
Sequence 1: | NP_001097920.1 |
Gene: | jigr1 / 43093 |
FlyBaseID: | FBgn0039350 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 23/72 - (31%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 203 NHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPTQPLAPLP 267
||..|...||.....:...|.|:..|....|...:.....|..::..|.....|..| .|..
Fly 46 NHDVELLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEP----GPNT 106
Fly 268 PAYAKFR 274
||..|.|
Fly 107 PAARKPR 113
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jigr1 | NP_001097920.1 |
MADF |
33..118 |
CDD:214738 |
|
CG32202 | NP_730354.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.