DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG8119

DIOPT Version :10

Sequence 1:NP_651409.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:161 Identity:37/161 - (22%)
Similarity:64/161 - (39%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAHI---WEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVE 94
            |:||....|.::|   .|.|..|....|   |..:::.:|......:.|..:|||.|   :.::.
  Fly    18 LLREIALRPSIWD---SRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY---RTKIH 76

  Fly    95 NGLSTQSSQWPLFESLQFLGDHIRPRR----SFKNMSVKEE----DEETYEVDDCRSDSNGHMNS 151
            .|   .:..||..:.::|:.|...|.:    :...:.||:.    ..:.| :....|.|......
  Fly    77 QG---NAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQY-LQSVASYSAFKKGG 137

  Fly   152 IKDELED------DSEIFDCEQALPVTTVLG 176
            |:.|.|:      |...||.:....||.:||
  Fly   138 IEFEAEERLFLVTDEPAFDLDVDEEVTRLLG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_651409.1 MADF 33..118 CDD:214738 21/87 (24%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 21/87 (24%)
BESS 201..234 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.