DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Hmr

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_572637.2 Gene:Hmr / 31988 FlyBaseID:FBgn0001206 Length:1413 Species:Drosophila melanogaster


Alignment Length:376 Identity:83/376 - (22%)
Similarity:138/376 - (36%) Gaps:111/376 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RATYAQTGEFDLGLIREYRS----------HPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATS 74
            |.||  .|..|.|:::.||:          .|:|||..:.:|:|.......|::||.:|..:||:
  Fly    38 RCTY--PGSRDGGILQTYRAERLLIALVRRQPLLYDARHPKFRDVAQREKQWKKIASRLATNATN 100

  Fly    75 IRERMTTLRNRYNIEKRRVEN------GLSTQSSQW-PLF---ESLQFLGDHIR---------PR 120
            .:...:.||.:|....||:.|      .....:.:| |..   |.::|:..|:.         |.
  Fly   101 CKRSWSALRYKYQRHVRRLRNFHRSAIQKDRAALRWRPCMEYEEEMRFMYTHVARFPLIVDKIPT 165

  Fly   121 RSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDD-----------SEIFDCEQALPV--- 171
            ...:    ||..:|:....|.....|..|:.|..::|:|           ..:.:...|.|:   
  Fly   166 EILE----KEHVDESETRPDVEVIENPPMDIIDLDVEEDPTYNYRCNRLQRRLIEAVSAYPLLYD 226

  Fly   172 TTVLGI-----------PLNNS--DEANKSQR-----STNGEMPNGKGYNHFAESYHR-RHQNQP 217
            :|..|.           .::|.  |:|.|..:     .|..|.          |..|| ||....
  Fly   227 STCTGYQNTRHRFLIWSAISNEVHDKATKLMKCWLKLQTRYEW----------ELIHRPRHIGTS 281

  Fly   218 EYIISSPIVNPMRSNKRG-----SQHLDD--HPSKRRVDDSLSISGYYPTQPLAP---------- 265
            |.......:.|.....||     |::|.:  |   ..:::..::.....|....|          
  Fly   282 ELCRLMDFMEPHVQRMRGTVCKSSKYLQNGWH---EPIENFHTVMALITTMRNMPELVQLTEDSL 343

  Fly   266 ----LPPAYAKF-RGFG-EFMC-HSLCDMPAATALRLVQKFTREL--VQSS 307
                .||.|.:| :..| |.|| |..|::   |.| :::.|..||  |:||
  Fly   344 HNKVKPPRYDEFWQKVGMEVMCSHEHCEV---TWL-VLRAFYHELQAVRSS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 25/104 (24%)
HmrNP_572637.2 MADF_DNA_bdg 59..149 CDD:287510 21/89 (24%)
GT1 213..295 CDD:304916 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.