DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and CG12155

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_572403.1 Gene:CG12155 / 31682 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster


Alignment Length:261 Identity:53/261 - (20%)
Similarity:97/261 - (37%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LGLIREYRSHPVLYD---RSNKRFKDKLYVAHIWEQIAHKLG--YDATSIRERMTTLRNRYNIEK 90
            |.||...|.:||||:   :.|:|.:..  |.:.|:::|.::|  |....:|.:...||:.::..:
  Fly    22 LTLINLVRQNPVLYNYKLQPNQRRRSD--VLNGWQEVAQQIGNKYTVQEVRRKWKNLRDTFHQYR 84

  Fly    91 RRVENGLSTQSSQWPLFESLQFLGDHIRPR-RSFKNMSVKEEDEETYEVDDCRSDSNG------- 147
            .|....:..:.|:|...:.|.||....:|: :|.:|..:      |||.........|       
  Fly    85 LRTPKYIEGRLSKWRYAKELDFLSKVYQPKLKSHRNTQI------TYETSGVAGAGGGIGGANST 143

  Fly   148 ------------HMNSIKDELEDDSEIFDCEQAL--------PVTTVLGIPLNNSDEA-----NK 187
                        |::...||:.||....|.:.|.        .:|.|       ||||     ..
  Fly   144 TLPIGAMLHLKQHVDDDDDEVMDDDGQSDHDTATLSSHHGTSQITLV-------SDEAETFILTA 201

  Fly   188 SQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSL 252
            .:...:.:..:...::|....:.:.|.:||.:                  |...|..:.:.|.|:
  Fly   202 YEEGVSDDTVSQHHHHHHHGHHQQEHHHQPHH------------------HHHHHHHQSQHDGSI 248

  Fly   253 S 253
            |
  Fly   249 S 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/89 (26%)
CG12155NP_572403.1 MADF 24..112 CDD:214738 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.