DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and HMGB2

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001124160.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:199 Identity:38/199 - (19%)
Similarity:65/199 - (32%) Gaps:67/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PNGK--GYNHFAESYHRRHQNQ-PEYIISSPIVNPMRSNKRGSQH-----------LDDHPSKRR 247
            |.||  .|..|.::....|:.: |:   ||  ||....:|:.|:.           .:|.....:
Human     9 PRGKMSSYAFFVQTCREEHKKKHPD---SS--VNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDK 68

  Fly   248 VDDSLSISGYYPTQ---------PLAPLPPAYAKFRGFGEFMCHSLCDMPAAT------------ 291
            ......:..|.|.:         |.||..|..|.|....|.......:.|..:            
Human    69 ARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMW 133

  Fly   292 --------------ALRLVQKFTRELVQSSLRNED----------SGSKEKTDEVDPVDQSSESQ 332
                          |.:|.:|:.:::.....:.:.          :|||:|.   :|.|:..|.:
Human   134 SEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKN---EPEDEEEEEE 195

  Fly   333 EEDE 336
            ||||
Human   196 EEDE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
HMGB2NP_001124160.1 HMG_box_2 6..78 CDD:401091 14/73 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 12/97 (12%)
HMG_box 95..162 CDD:395407 9/66 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 11/41 (27%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 0/14 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.