DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and HMGB1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001300821.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:197 Identity:37/197 - (18%)
Similarity:67/197 - (34%) Gaps:59/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PNGK--GYNHFAESYHRRHQNQ-PEYIIS--------SPIVNPMRSNKRGSQHLDDHPSKRRVDD 250
            |.||  .|..|.::....|:.: |:..::        |.....|.:.::|.  .:|.....:...
Human     9 PRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGK--FEDMAKADKARY 71

  Fly   251 SLSISGYYPTQ---------PLAPLPPAYA----------KFRG-------------FGEFMCHS 283
            ...:..|.|.:         |.||..|..|          |.:|             .||...::
Human    72 EREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNT 136

  Fly   284 LCD--MP-AATALRLVQKFTREL-----------VQSSLRNEDSGSKEKTDEVDPVDQSSESQEE 334
            ..|  .| ...|.:|.:|:.:::           .:..:...:...|:|.:|.|..|:..|.:||
Human   137 AADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEE 201

  Fly   335 DE 336
            ||
Human   202 DE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
HMGB1NP_001300821.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 16/89 (18%)