DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Tox3

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006255249.1 Gene:Tox3 / 291908 RGDID:1311529 Length:579 Species:Rattus norvegicus


Alignment Length:239 Identity:48/239 - (20%)
Similarity:74/239 - (30%) Gaps:79/239 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SDSNGHMNSIKDELEDDSEIFDCEQALPVTT-------VLGIPLNNSDEANKSQRSTNGEMPNGK 200
            |:...|..|:.||          |..:|..|       .||:|     :.....::.:..:|: :
  Rat    49 SEQTFHTPSLGDE----------EFEIPPITPPPESDPTLGMP-----DVLLPFQTLSDPLPS-Q 97

  Fly   201 GYNHFAESYHRRHQNQPEYIISSPIVNP---MRSNKRGSQHLDD---HPSKRRVDDSLSI----- 254
            | |.|...:..:..:.|...||..:|..   :.||   ..|:|.   ..|:.|.|.||.:     
  Rat    98 G-NEFTPQFPPQSLDLPSITISRNLVEQDGVLHSN---GLHMDQSHTQVSQYRQDPSLVMRSIVH 158

  Fly   255 ------SGYYPTQPL------------------------APLPPAYAKFRGFGEFMCHSLCDMPA 289
                  ||..|...|                        :|.|||           ..|....|:
  Rat   159 MTDAARSGIMPPAQLTTINQSQLSAQLGLNLGGASVPHTSPSPPA-----------SKSATPSPS 212

  Fly   290 ATALRLVQKFTRELVQSSLRNEDSGSKEKTDEVDPVDQSSESQE 333
            ::........|...|.......|||.|.||.:.......:|.|:
  Rat   213 SSINEEDADETNRAVGEKRTAPDSGKKPKTPKKKKKKDPNEPQK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
Tox3XP_006255249.1 HMG-box 254..319 CDD:238037 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.