DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Tox4

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_075923.2 Gene:Tox4 / 268741 MGIID:1915389 Length:619 Species:Mus musculus


Alignment Length:300 Identity:50/300 - (16%)
Similarity:82/300 - (27%) Gaps:126/300 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EETYEVDDCRSDSN---------GHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKS 188
            :|.:|:.....||:         ||.:.:.|........|..:..:   ..|.:|:.        
Mouse    34 DEEFEIPPISLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGV---QTLDMPVG-------- 87

  Fly   189 QRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPI---------------------------- 225
              .|:|.|..|.|......:....|....:|..:.|:                            
Mouse    88 --MTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELS 150

  Fly   226 ------------------------VNPMRSNKRGSQHLDDH--------------------PSKR 246
                                    ..|..:|......:||.                    |.||
Mouse   151 SQLGLSLGGGTILPPAQSPEDRLSTTPSPTNSLHEDGVDDFRRQLPAQKTVVVETGKKQKAPKKR 215

  Fly   247 RVDDSLSISGYYPTQPLAPLPPAYAKF--------RG------FGEF------MCHSLCDMPAAT 291
            :..|        |.:|..|: .|||.|        :|      |||.      |..||.:.....
Mouse   216 KKKD--------PNEPQKPV-SAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQV 271

  Fly   292 ALRLVQKFTRELVQSSLR---NEDSGSKEKTDEVDPVDQS 328
            ..|..:...:|.:::...   |::..:..:|.|:|||.||
Mouse   272 YKRKTEAAKKEYLKALAAYKDNQECQATVETVELDPVPQS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
Tox4NP_075923.2 NHP6B 140..>306 CDD:227935 27/174 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 10/79 (13%)
Nuclear localization signal. /evidence=ECO:0000255 213..218 2/4 (50%)
HMG-box 223..288 CDD:238037 15/65 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..335 4/5 (80%)
PHA03160 <464..530 CDD:165431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.