DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Tox3

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_766501.2 Gene:Tox3 / 244579 MGIID:3039593 Length:575 Species:Mus musculus


Alignment Length:143 Identity:33/143 - (23%)
Similarity:52/143 - (36%) Gaps:27/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SQRSTNGEMPNGKGYNHF----AESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRV 248
            |:...|..|...:..|.|    .:::|.......|:.| .||..|..|                 
Mouse    28 SKLGNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEI-PPITPPPES----------------- 74

  Fly   249 DDSLSI-SGYYPTQPLA-PLPPAYAKFRGFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNE 311
            |.:|.: ....|.|.|: |||....:|.  .:|...|| |:|:.|..|.:.:....|..:.|..:
Mouse    75 DPTLGMPDALLPFQTLSDPLPSQGTEFT--PQFPPQSL-DLPSITISRNLVEQDGVLHSNGLHMD 136

  Fly   312 DSGSKEKTDEVDP 324
            .|.::......||
Mouse   137 QSHTQVSQYRQDP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
Tox3NP_766501.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258
HMG-box 254..319 CDD:238037
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.