DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and madf-3

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:289 Identity:56/289 - (19%)
Similarity:105/289 - (36%) Gaps:99/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDA--TSIRERMTTLRNRYNIEKR 91
            |:|.||...|....|:|.:::::::..|...:|:::...||:|.  ..:..|...||::|..|||
 Worm     6 FNLRLIEAVRHSRCLFDNTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKEKR 70

  Fly    92 RVENGLSTQSSQWPLFESLQFLGDHIRPRRSF--------------------KNMSVK------- 129
            :.:.|  .:.|.|..|:.|.||..|:..|...                    ||:.::       
 Worm    71 KQKYG--NEKSSWQYFKHLHFLDPHMTDRAEISPSRKEPTGVHEKIAEPCFGKNLILEVRRHPCL 133

  Fly   130 -EEDEETYEVDDCRSDSNG---------------------HMN---------------SIKD--- 154
             :..:..|...|||:.:.|                     |.:               :::|   
 Worm   134 YDVRDPKYRHGDCRTQAWGMIIDKLRYPGTVPSIYKQWKKHRDRYVREKRRLRNLGDPNVQDVST 198

  Fly   155 -ELEDDSEIFD----------CEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAES 208
             |:.||....|          |.::|...       .|:|..|:.:.|..|:..:...|...|| 
 Worm   199 WEMYDDMAWIDQHLDEQQLSRCARSLKRG-------GNNDGGNQDEMSDYGDYDDDINYVMMAE- 255

  Fly   209 YHRRHQNQPEYII------SSPIVNPMRS 231
               :..|..:.::      |:.||:.:|:
 Worm   256 ---KRPNNGDVLLDGDSAFSASIVSDLRT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 25/86 (29%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 24/86 (28%)
MADF 122..212 CDD:214738 12/89 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.