DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and madf-4

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:283 Identity:61/283 - (21%)
Similarity:100/283 - (35%) Gaps:73/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDA--TSIRERMTTLRNRY-NIE 89
            :|.|.||...:.:|.:|:|.:...|...|...||:.|:.::|||.  ..:..:...:|::| .:.
 Worm    17 DFTLALIDSVQRNPCVYNRYDPLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDKYVRLR 81

  Fly    90 KRRVENGLSTQSSQW-PLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNS-I 152
            |:..:.....::::| ..:..:.||..::..|.                    |.....::|| .
 Worm    82 KQDKQKAPIKKTNKWYNYYHKMSFLDPYVEHRN--------------------RKRQKDYLNSNT 126

  Fly   153 KDELEDDSEIFDCEQALPVTTVLGIP---LNNSDEANKSQRSTNGEMPNGKGYN-HFAES----- 208
            .|.|:||:...|   .|.|..:|. |   |.::|....|..:|:....:|...| .|.:|     
 Worm   127 PDFLDDDTAFLD---GLSVKEMLK-PESLLTSNDAGYNSPHTTSSSSSSGSNNNGRFLDSPTIDI 187

  Fly   209 ----------YHRRHQNQPEYIISSPIVNPMRSNKRGSQHL--------------DDHPSKRRVD 249
                      |.:...||.|     ...|...|||.|...|              ...||..|..
 Worm   188 EDDKKNLALIYDKFVANQTE-----NEKNHRFSNKHGKDLLFSTTNTLIEKLATTSTAPSSSRKR 247

  Fly   250 DSLSISGYYPTQPLAPLPPAYAK 272
            ..:      |.|.|...||...|
 Worm   248 KPI------PVQILPSSPPPQEK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/88 (22%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.