DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Hmgb3

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001280552.1 Gene:Hmgb3 / 15354 MGIID:1098219 Length:200 Species:Mus musculus


Alignment Length:197 Identity:41/197 - (20%)
Similarity:69/197 - (35%) Gaps:62/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PNGK--GYNHFAESYHRRHQNQ-PEYIISSPIVNPMRSNKRGSQH-----------LDDHPSKRR 247
            |.||  .|..|.::....|:.: ||.    | ||....:|:.|:.           .|:.....:
Mouse     9 PKGKMSAYAFFVQTCREEHKKKNPEV----P-VNFAEFSKKCSERWKTMSSKEKSKFDEMAKADK 68

  Fly   248 VDDSLSISGYYPTQ-------PLAPLPPAYAKFRGFGEF----------------------MCHS 283
            |.....:..|.|.:       |.||..|....|....||                      |.::
Mouse    69 VRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNN 133

  Fly   284 LCD---MPAAT-ALRLVQKFTRELVQSSLRNEDSGSK----------EKTDEVDPVDQSSESQEE 334
            |.|   .|..| |.:|.:|:.:::.....:.:..|:|          |:.:|.:..::..|.:||
Mouse   134 LSDNEKQPYVTKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEEEEEEEEEEEEEEEE 198

  Fly   335 DE 336
            ||
Mouse   199 DE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738
Hmgb3NP_001280552.1 HMG_box_2 13..78 CDD:370242 12/69 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..97 5/25 (20%)
HMG_box 93..160 CDD:366139 13/66 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.