DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Hmg20b

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006513311.1 Gene:Hmg20b / 15353 MGIID:1341190 Length:415 Species:Mus musculus


Alignment Length:361 Identity:71/361 - (19%)
Similarity:115/361 - (31%) Gaps:138/361 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPKGRGRPRATYAQTGEFDLGLIREYRS-----HP----------------VLYDRSNKRFKDKL 55
            ||.|...|...|.:       .:.|.|.     ||                .|.....:|:.|:.
Mouse    66 LPNGPKAPVTGYVR-------FLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEA 123

  Fly    56 ------YVAHIW---EQIAHKLGYDATSIRER-----------MTTLRNRYNIEKRRVE-NGLST 99
                  |:..:|   :..|:|:..:  .|:|.           |.||.|.:    :.|: :|.||
Mouse   124 EKEKQQYLKELWAYQQSEAYKVCTE--KIQENKIKKEDSSSGLMNTLLNGH----KGVDCDGFST 182

  Fly   100 QSSQWPLFESLQFLGDHIRPR----RSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDD- 159
              ...|:|.. :|| |..:.|    |..:.|:|..|::........:|     |:|.::.||.: 
Mouse   183 --FDVPIFTE-EFL-DQNKAREAELRRLRKMNVAFEEQNAVLQRHTQS-----MSSARERLEQEL 238

  Fly   160 -----------SEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYH--- 210
                       .::....||| ..:...:|:..:           ||.|.....:.:....|   
Mouse   239 ALEERRTLALQQQLQAVRQAL-TASFASLPVPGT-----------GETPTLGTLDFYMARLHGAI 291

  Fly   211 RRHQNQPEYIIS---------SPIVN-----------PMRSNKRGSQ------------HLDDHP 243
            .|...|.|.:|:         :|:.:           |.||...||.            ..:.||
Mouse   292 ERDPAQHERLIARVKEILARRAPVTDLLDQEMPLPTRPERSYTLGSPGPPQMKSQPHPFSFEPHP 356

  Fly   244 SKRRVDD--------SLSISGYYPTQPL---APLPP 268
            ..:|..|        ..|.||....:||   .|.||
Mouse   357 RLQRPGDLPASQGGSHYSGSGTEEPRPLDSDTPPPP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 26/126 (21%)
Hmg20bXP_006513311.1 HMGB-UBF_HMG-box 70..134 CDD:238686 10/70 (14%)
OmpH 190..>254 CDD:214922 13/70 (19%)
FAM222A <314..>400 CDD:373691 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.